KEGG   Sphingobium sp. SYK-6: SLG_04290Help
Entry
SLG_04290         CDS       T01622                                 

Definition
(GenBank) putative DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
ssy  Sphingobium sp. SYK-6
Pathway
ssy03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:ssy00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    SLG_04290
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ssy03400]
    SLG_04290
Enzymes [BR:ssy01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     SLG_04290
DNA repair and recombination proteins [BR:ssy03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     SLG_04290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: BAK65104
NITE: SLG_04290
UniProt: G2IL41
LinkDB All DBs
Position
complement(448909..451416)
Genome map
AA seq 835 aa AA seqDB search
MARTDPLAAYNAKRDFGKTPEPAGEARRSEGGNLFVVQKHDATRLHWDFRLEMDGVLKSW
AVTKGPSLDPHDKRLAVRTEDHPLSYAQFEGGIPEGEYGGGTVMLWDQGVWAPIKGKSAK
DIEKGHLHFELHGERMKGEWLLVRMKPRPGEKRENWLLRKIDDAEAGTGDILVERELTSV
LTGRTMAEIAADREGVRSLAGKRGKAFNAVMADAAAHNRQTARGPARRQNKDARLPGFEA
VQLATLVDTVPTGNQWMHEIKFDGYRVLAAVMGAQVRLFTRSGLDWTEKFPPIAEALAAL
DLPAALIDGEVVALDGHGNPSFSALQAALKEGRDATLAYFAFDLLSLAGEDLKALPNIER
KERLEALLRQATAPVQVADHVIGAGEALFETLCSAGQEGIIAKRVDAPYRGKRTHNWLKI
KCTRRQEFVILGWTKSAARGRAFASLLLGQHEDGKLVYKGKVGTGFDRATMEDLAKRMGR
LARATAPAEVPRSEARGAQWLSPKLVGEIAFAEFTAEGRVRHGSFLGLRSDKEAKDVTPE
TPADTPEPRSDIRISSPDRVVFPESGQTKGELADYYRAIAPLMLPFAAGRPISLVRCPQG
RARHCFFQKHDSGSFGPHVSHVPIREKDGGTEDYLYLTDADGILACVQMGTIEFHGWGAK
AEDVEQPDRMIFDLDPDEGLGFDEVKRAARDIRRRLSDLGLVSFAMLSGGKGVHVVVPLT
PDHDWETHKDFSKRFAEALSLAEPDRFVATMSKAKRKGRIFIDWLRNQRGSTAVLPYSAR
ARAGAPVAIPISWEELDKMKDAHPFSISDAKTLMDRARDKALQGWGFVTQSLPDH
NT seq 2508 nt NT seq  +upstreamnt  +downstreamnt
atggcgcggaccgatccgctcgccgcctataatgcgaagcgcgacttcgggaagacgccg
gagccggccggcgaggcccggcgcagcgaaggcggcaatctcttcgtggtgcagaagcac
gacgcgacgcgcctgcactgggacttccgcctcgagatggatggcgtgctcaagagctgg
gccgtgacgaaggggcccagcctcgacccccatgacaagcggctcgccgtgcgcaccgag
gaccatccgctttcctacgcgcagttcgagggcggcattcccgagggggaatatggcggc
ggcacggtgatgctctgggatcagggcgtctgggcgccgatcaagggcaagagcgcgaag
gacatcgagaagggccatctccatttcgagctccatggcgagcgcatgaagggcgaatgg
ctgctggtccgcatgaagccccgcccgggcgagaagcgcgagaactggctgctgcgcaag
atcgacgatgccgaagccggcaccggggacattctggtcgagcgcgaactgaccagcgtg
ctcaccggccgcacgatggcggaaatcgctgccgatcgcgaaggcgtgcgctcgctcgcc
ggcaagcggggcaaggcattcaatgccgtgatggccgacgcggcggcgcataaccgccaa
accgcccgggggcccgctcgccgccagaacaaggacgcccggctcccgggcttcgaggcc
gtgcaactcgcgaccctcgtcgacaccgtgcccaccggcaaccagtggatgcacgagatc
aagttcgacggctatcgggtgctggcggcggtcatgggcgcgcaggtgcgcctgttcacg
cgctccggcctcgactggaccgagaaattcccgccgatcgccgaggcgctggccgcgctc
gacctgcccgccgcgctgatcgacggcgaagtcgtggcgctggacgggcacggcaatccc
agcttctccgccttgcaggccgcgctcaaggaaggacgggatgcgacactcgcttatttc
gccttcgatctgctcagccttgccggcgaggacctgaaagccctgccaaacatcgagcgc
aaggagcggctcgaagcgctactgcgccaggcgacggcccccgtgcaggtcgccgatcat
gtcatcggcgcgggcgaagcgcttttcgagactttgtgcagcgcggggcaggaaggcatc
atcgccaagcgggtggatgcgccctatcgcggcaagcggacacacaactggctcaagatc
aaatgcacgcgccggcaggaattcgtgatattgggctggacgaagagcgcggcgcgcggc
cgcgccttcgcctcgctgctgctcgggcagcatgaagacggcaagctggtctacaagggc
aaggtcggcaccggattcgaccgggcgacgatggaggatctggcgaagcgaatgggcagg
ctcgcacgcgccaccgccccggcggaggtgccgcggagcgaggcccggggcgcgcaatgg
ctgagcccgaagctggtgggcgagatcgcctttgccgaattcacggcggaaggccgcgtt
cgccacgggagcttcctcggcctgcgcagcgacaaggaggcgaaagacgtgacgcccgaa
acgcctgccgacacgccggagccgcgcagcgacatccgcatatccagtccggaccgcgtc
gtctttcccgaaagcgggcaaaccaagggagagcttgcggattattaccgcgcgatcgcg
ccgctgatgctgccgttcgcggcgggccggccgatcagcctcgtgcgctgcccgcaggga
cgggcgcggcactgcttcttccagaagcatgacagcggctcgtttggcccgcacgtctcc
cacgtcccgatccgcgaaaaggacggcgggaccgaggattatctctacctcaccgatgcg
gacggcattctcgcctgcgtgcagatgggcacgatcgagttccacggctggggcgcgaag
gcggaggatgtggagcagcccgaccggatgatcttcgacctcgatcccgacgagggcctc
gggttcgacgaagtgaagcgcgccgcacgggacatccggcggcgactctccgacctgggg
ctggtgagcttcgcgatgctctccggcggcaagggcgtgcatgtggtggtgccgctgacg
cccgaccacgattgggaaacgcacaaggacttctcaaagcgcttcgccgaggcgctgagc
cttgccgagccggaccgcttcgtcgcgacgatgagcaaggcgaagcgcaagggccgcatc
ttcatcgactggctgcgcaaccagcgcggcagcacggcggtgctgccctattcggcccgc
gcccgcgccggcgcgccggtcgcgataccgatcagctgggaagagctggacaagatgaag
gacgcgcatcctttcagcatcagcgatgccaagaccctcatggaccgggcgcgggacaag
gcgttgcagggctgggggttcgtcacgcagagcctgccggaccactga

DBGET integrated database retrieval system