KEGG   Sphingomonas taxi: MC45_06870Help
Entry
MC45_06870        CDS       T03398                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
stax  Sphingomonas taxi
Pathway
stax00071  Fatty acid degradation
stax00072  Synthesis and degradation of ketone bodies
stax00280  Valine, leucine and isoleucine degradation
stax00310  Lysine degradation
stax00362  Benzoate degradation
stax00380  Tryptophan metabolism
stax00620  Pyruvate metabolism
stax00630  Glyoxylate and dicarboxylate metabolism
stax00640  Propanoate metabolism
stax00650  Butanoate metabolism
stax00900  Terpenoid backbone biosynthesis
stax01100  Metabolic pathways
stax01110  Biosynthesis of secondary metabolites
stax01120  Microbial metabolism in diverse environments
stax01200  Carbon metabolism
stax01212  Fatty acid metabolism
stax02020  Two-component system
Brite
KEGG Orthology (KO) [BR:stax00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MC45_06870
   00630 Glyoxylate and dicarboxylate metabolism
    MC45_06870
   00640 Propanoate metabolism
    MC45_06870
   00650 Butanoate metabolism
    MC45_06870
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MC45_06870
   00072 Synthesis and degradation of ketone bodies
    MC45_06870
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MC45_06870
   00310 Lysine degradation
    MC45_06870
   00380 Tryptophan metabolism
    MC45_06870
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MC45_06870
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MC45_06870
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MC45_06870
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:stax04147]
    MC45_06870
Enzymes [BR:stax01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MC45_06870
Exosome [BR:stax04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MC45_06870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AIT06160
UniProt: A0A097EF15
LinkDB All DBs
Position
1531797..1532975
Genome map
AA seq 392 aa AA seqDB search
MRSAVIVSTARTPIGRAYRGAFNDTTPQALAAHAISHAVQRAGLDGAEVEDVVIGAALQQ
GHQAGNIARQSALRAGLPISVPGMSLDRQCASGLMAIATAAKQIVLDGMDIAVGGGVESV
SLVQTPQMRVAPDKQLIAMHGDIYMPMLQTAEVVAKRYGISREAQDAYGLQSQQRTAAAQ
AAGRFDAEIVPLSATMNVVDKATKAVSTKDVTLSKDEGNRADTTLEGLQALQPVVGPDGV
ITAGNASQLSDGASAAVLMEESVAAARGLTPLGRYVGMAVAGTKPDEMGIGPVYAVPKLL
EKNGLTMADIGLWELNEAFAVQVLSCRDTLGIPDELLNVNGGAISIGHPYGMSGARMTGH
ALIEGKRRGAKYVVVTMCVGGGMGAAGLFEVL
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgcgctccgccgtcatcgtctccaccgcccgcaccccgatcggccgcgcctatcgcggc
gccttcaacgacaccacgccgcaggcgctcgccgcccatgcgatcagccacgcggtccag
cgcgccggcctcgacggcgccgaggtggaggacgtggtgatcggcgccgcactccagcag
ggccatcaggccggcaacattgcccgccagtcggccttgcgcgccggcctgccgatctcg
gtgccgggcatgtcgctcgaccgccaatgcgccagcggcctgatggcgatcgccaccgcc
gccaagcagatcgtgctcgacggcatggacatcgcggtcggcggcggcgtcgagagcgtc
agcctcgtccagaccccgcagatgcgcgtcgcccccgacaagcagctgatcgcgatgcac
ggcgacatctacatgccgatgctccagaccgccgaggtcgtcgccaagcgctacggcatc
agccgcgaggcgcaggacgcctatggcctccagtcgcagcagcgcaccgccgccgcgcag
gccgccggccgcttcgacgccgagatcgtaccgctgtcggcgacgatgaacgtggtcgac
aaggcgaccaaggcggtcagcaccaaggacgtcactttgtcgaaggacgagggcaaccgt
gccgacacgacgctggaaggcttgcaggcgctgcaacccgtcgtcggccccgacggcgtc
atcaccgccggcaacgccagccagctttccgacggcgcctcggccgcggtgctgatggag
gagagcgtcgccgccgcgcgcggcctcaccccgctcggccgctatgtcggcatggcggtc
gccggcacaaagcccgacgaaatgggcatcggcccggtctacgccgtccccaagctgctc
gagaagaacggcctgacgatggccgacatcggcctgtgggaactcaacgaggcgttcgcg
gtgcaggtcctctcctgccgcgacacgctcggcatccctgacgagctgctcaacgtcaac
ggcggcgcgatctcgatcggccatccctacggcatgtcgggcgcccgcatgaccggtcat
gcgctgatcgaaggcaagcgccgcggcgcaaagtatgtcgtcgtgacgatgtgcgtcggc
ggcggcatgggcgcggcgggcctgttcgaggtgctgtga

KEGG   Sphingomonas taxi: MC45_06975Help
Entry
MC45_06975        CDS       T03398                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
stax  Sphingomonas taxi
Pathway
stax00071  Fatty acid degradation
stax00072  Synthesis and degradation of ketone bodies
stax00280  Valine, leucine and isoleucine degradation
stax00310  Lysine degradation
stax00362  Benzoate degradation
stax00380  Tryptophan metabolism
stax00620  Pyruvate metabolism
stax00630  Glyoxylate and dicarboxylate metabolism
stax00640  Propanoate metabolism
stax00650  Butanoate metabolism
stax00900  Terpenoid backbone biosynthesis
stax01100  Metabolic pathways
stax01110  Biosynthesis of secondary metabolites
stax01120  Microbial metabolism in diverse environments
stax01200  Carbon metabolism
stax01212  Fatty acid metabolism
stax02020  Two-component system
Brite
KEGG Orthology (KO) [BR:stax00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MC45_06975
   00630 Glyoxylate and dicarboxylate metabolism
    MC45_06975
   00640 Propanoate metabolism
    MC45_06975
   00650 Butanoate metabolism
    MC45_06975
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MC45_06975
   00072 Synthesis and degradation of ketone bodies
    MC45_06975
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MC45_06975
   00310 Lysine degradation
    MC45_06975
   00380 Tryptophan metabolism
    MC45_06975
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MC45_06975
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MC45_06975
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MC45_06975
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:stax04147]
    MC45_06975
Enzymes [BR:stax01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MC45_06975
Exosome [BR:stax04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MC45_06975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AIT06178
UniProt: A0A097EF23
LinkDB All DBs
Position
1555213..1556400
Genome map
AA seq 395 aa AA seqDB search
MSTDPVVIVSYARTPMGSFQGALAGASATELGAAAVKAAVDRAGASAEAIERIYMGCVLP
AGLGQAPARQAAIGAGLGTHVEATTVNKMCGSGMQAAIMAADALAAGSVDLLVAGGMESM
TNAPYLSRKHRGGARIGHDTFYDHMYLDGLEDAYEPGKLMGNFAEDTAADYQFTRKAMDD
YAIESLHRAQRAQGSGAFDREIVPVEVKGRKGSTTVALDEQPAKGDVAKIPTLKPAFSRE
GTITAANASSISDGAAALVMTRASVAERLGLTPIARVVAHAAHAHDPAKFTTAPVFAMRK
AMDRAGWSRDDIDLFEVNEAFAVVSMIAIHDLGIDPARLNVHGGACALGHPIGASGARIL
ATLLSALETNGQRRGMASLCIGGGEATAMAVELMN
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccgatcccgtcgtcatcgtcagttacgcccgcacgccgatgggctcgttccag
ggtgcgctcgccggcgcttcggcgaccgagctcggcgccgccgcggtcaaggccgcggtc
gaccgtgccggtgcctcggcggaggcgatcgagcgtatctacatgggctgcgtcctgccc
gccgggctcggccaggcccccgcccggcaggcggcgatcggcgccgggctcggcacgcat
gtcgaggcgacgacggtgaacaagatgtgcggatcgggcatgcaggcggcgatcatggcc
gccgatgcgctcgccgcggggtcggtcgacctgctggtggcgggcggcatggagagcatg
accaacgccccctatctctcgcgcaagcatcgcggcggcgcgcgcatcggccacgacacc
ttctacgaccatatgtatctcgacgggctcgaggatgcctatgagcccggcaagctgatg
ggcaatttcgccgaggataccgccgccgactatcagttcacccgcaaggcgatggacgat
tacgcgatcgagtcgctgcaccgcgcgcagcgcgcgcaggggtcgggcgcgttcgatcgc
gagatcgtgccggtcgaggtgaagggccgcaagggttcgaccaccgtcgcgctcgacgaa
cagccggccaagggcgacgtcgccaagatcccgacgcttaagcccgctttctcgcgggag
ggcacgatcaccgccgccaacgcctcgtcgatctccgacggtgcggcggcgctggtgatg
acccgcgccagcgtcgccgagcggctcggcctcaccccgatcgcccgcgtcgtcgcgcat
gccgcgcacgcgcacgatccggccaaattcaccaccgcgccggtgttcgcgatgcgcaag
gcgatggaccgcgccggctggagccgcgacgacatcgacctgttcgaggtcaacgaggcg
ttcgcggtggtgtcgatgatcgcgatccacgatctcggcatcgaccccgcccgcctcaac
gtccacggcggcgcctgcgcactcggccatccgatcggcgcgagcggcgcgcgcatcctc
gcgaccctgctgtcggcgctcgagacgaacggccagcgccgcggcatggcgtcgctgtgc
atcggcggcggcgaggcgaccgcgatggcggtcgaactgatgaactga

KEGG   Sphingomonas taxi: MC45_10320Help
Entry
MC45_10320        CDS       T03398                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
stax  Sphingomonas taxi
Pathway
stax00071  Fatty acid degradation
stax00072  Synthesis and degradation of ketone bodies
stax00280  Valine, leucine and isoleucine degradation
stax00310  Lysine degradation
stax00362  Benzoate degradation
stax00380  Tryptophan metabolism
stax00620  Pyruvate metabolism
stax00630  Glyoxylate and dicarboxylate metabolism
stax00640  Propanoate metabolism
stax00650  Butanoate metabolism
stax00900  Terpenoid backbone biosynthesis
stax01100  Metabolic pathways
stax01110  Biosynthesis of secondary metabolites
stax01120  Microbial metabolism in diverse environments
stax01200  Carbon metabolism
stax01212  Fatty acid metabolism
stax02020  Two-component system
Brite
KEGG Orthology (KO) [BR:stax00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MC45_10320
   00630 Glyoxylate and dicarboxylate metabolism
    MC45_10320
   00640 Propanoate metabolism
    MC45_10320
   00650 Butanoate metabolism
    MC45_10320
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MC45_10320
   00072 Synthesis and degradation of ketone bodies
    MC45_10320
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MC45_10320
   00310 Lysine degradation
    MC45_10320
   00380 Tryptophan metabolism
    MC45_10320
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MC45_10320
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MC45_10320
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MC45_10320
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:stax04147]
    MC45_10320
Enzymes [BR:stax01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MC45_10320
Exosome [BR:stax04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MC45_10320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AIT06703
UniProt: A0A097EGM4
LinkDB All DBs
Position
2293004..2294176
Genome map
AA seq 390 aa AA seqDB search
MTEIVITAAKRTPVGSFLGAFATTPAHELGRVAIEAALAQAGVDGADVSEVILGQVLTAA
QGQNPARQASMAAGIPKEVPAWGVNQVCGSGLRAVALACQAIQTGDATIVVAGGQESMSM
SAHAQTMRGGTKMGAVSLVDTMVVDGLTDVFNGYHMGITAENLAEQYQVTRADQDAFSVA
SQNKAEAARGSGRFKDEIAPVTIKGRKGDTVVADDEYIRAGATIESVGGVRPAFKKDGTV
TAANASGLNDGAAALVLMSRAEAEARGTPVLATIRSWASAGVDPSVMGIGPVPASRKALE
KAGWTLADLDLIEANEAFAAQALSVGKELGWDADKVNVNGGAIAIGHPIGASGARVLTTL
LYEMEKRDAKKGLATLCIGGGMGIAMCVER
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagatcgtcatcaccgccgccaagcgtacccccgtcggcagcttcctcggcgcc
ttcgccaccacccccgcgcacgaactgggccgcgtcgcgatcgaggcggcgctcgcccag
gccggcgtcgacggcgccgacgtgtcggaggtgatcctcggccaggtgctcaccgcggcg
caggggcagaatccggcgcggcaggcgtcgatggcggcgggcatccccaaggaggtgccg
gcctggggcgtcaatcaggtgtgcggctcgggcctgcgcgcggtcgcgctcgcctgtcag
gcgatccagaccggcgacgcgacgatcgtcgtcgccggcggacaggagagcatgtcgatg
agcgcgcatgcgcagacgatgcgcggcggcaccaagatgggcgcggtcagcctcgtcgac
acgatggtggtcgacggcctcaccgacgtgttcaacggctatcacatggggatcaccgcg
gagaatctcgccgagcaatatcaggtgacgcgcgccgaccaggacgccttctcggtcgcc
agccagaacaaggcggaggccgcgcgcggcagcggccgcttcaaggacgagatcgccccg
gtgacgatcaagggccgcaagggcgacaccgtcgtggcggacgacgaatatatccgcgcc
ggcgcgacgatcgagagcgtcggcggcgtacggccggcgttcaagaaggacggcaccgtc
accgccgccaatgcgagcggcctcaacgacggcgccgcggcgctggtgctgatgagccgc
gccgaggccgaggcgcgcggcacgccggtgctcgcgacgatccggagctgggcgagcgcg
ggcgtcgatccgtcggtgatgggcatcggcccggtgccggcatcgaggaaggcgctggag
aaggccggctggacgctcgccgacctcgacctgatcgaggcgaacgaggcgttcgcggcg
caggcgctgtcggtcggcaaagaactcggctgggatgcggacaaggtcaacgtcaacggc
ggcgcgatcgcgatcggccacccgatcggcgccagcggcgcgcgcgtgctgaccacgctg
ctctacgagatggaaaagcgcgatgcgaagaaggggctggcgaccttgtgcatcggcggc
gggatggggatcgcgatgtgcgtcgagcggtga

KEGG   Sphingomonas taxi: MC45_16575Help
Entry
MC45_16575        CDS       T03398                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
stax  Sphingomonas taxi
Pathway
stax00071  Fatty acid degradation
stax00072  Synthesis and degradation of ketone bodies
stax00280  Valine, leucine and isoleucine degradation
stax00310  Lysine degradation
stax00362  Benzoate degradation
stax00380  Tryptophan metabolism
stax00620  Pyruvate metabolism
stax00630  Glyoxylate and dicarboxylate metabolism
stax00640  Propanoate metabolism
stax00650  Butanoate metabolism
stax00900  Terpenoid backbone biosynthesis
stax01100  Metabolic pathways
stax01110  Biosynthesis of secondary metabolites
stax01120  Microbial metabolism in diverse environments
stax01200  Carbon metabolism
stax01212  Fatty acid metabolism
stax02020  Two-component system
Brite
KEGG Orthology (KO) [BR:stax00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MC45_16575
   00630 Glyoxylate and dicarboxylate metabolism
    MC45_16575
   00640 Propanoate metabolism
    MC45_16575
   00650 Butanoate metabolism
    MC45_16575
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MC45_16575
   00072 Synthesis and degradation of ketone bodies
    MC45_16575
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MC45_16575
   00310 Lysine degradation
    MC45_16575
   00380 Tryptophan metabolism
    MC45_16575
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MC45_16575
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MC45_16575
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MC45_16575
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:stax04147]
    MC45_16575
Enzymes [BR:stax01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MC45_16575
Exosome [BR:stax04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MC45_16575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_C
Motif
Other DBs
NCBI-ProteinID: AIT07714
UniProt: A0A097EJH1
LinkDB All DBs
Position
3627628..3628779
Genome map
AA seq 383 aa AA seqDB search
MSIRGKAHIAGVFEHPGRDLPDHSVQQIHAECAIGALADAGLSIRDVDGYFSTGQLGFGG
VSLTEYLGLAPRYVDATFVGGSSYLSHVGHAAAAIAAGKCRVALITQGAKVRGVIRGNKH
TADTPEFPFETVYGETNAGIYALAARRHMHDYGTTAAQLAAAKVTASEYAQHNPAALLRK
LVTVDDVVHSPMIADPLHRLDCCVVTDGGGAIVVVAPEIARSLQRRSVTVLGHGEAIRHG
GRGAIDFTSTGATISGPSALAEAGVALADIDYASIYDSFTITVIMTLEDLGFCKKGEGGA
FVASGALRRDGAIPVNTDGGGLCNNHPGYQGGMVKIVEAVRQLRGEAHAETQVRDCELAI
AHGTGGGMSRQASVSLILGREDA
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgagcattcgcggcaaggcccatatcgccggggtcttcgaacatcccggacgcgatctg
cccgatcattcggtgcagcagatccatgccgaatgcgcgatcggcgcgctggccgatgcc
gggctgtcgatccgcgatgtcgacggctatttctcgaccgggcaactgggcttcggcggc
gtctcgctgaccgaatatctcggcctggcgccgcgctatgtcgatgcgacgttcgtcggc
ggctcgtcctatctgtcgcacgtcggccatgcggcggcggcgatcgcggcgggcaaatgc
cgcgtcgcgctcatcacccagggcgccaaggtgcgcggcgtcatccgcggcaacaaacat
accgccgacacaccggaatttccgttcgagacggtatatggcgagaccaatgcgggcatc
tatgcgctcgccgcgcggcgccacatgcacgactatggcacgaccgcggcgcagctcgcc
gccgccaaggtcaccgcctcggaatatgcgcaacacaatcccgctgcgctgctcaggaag
ctggtcacggtcgacgacgtcgtccattcgccgatgatcgccgacccgctgcaccggctc
gactgctgcgtcgtcacggatggcggtggcgcgatcgtcgtcgtcgcgccagagatcgcg
cgcagcctccaacgccgctcggtgacggtccttggccatggcgaggcgatccggcatggc
ggtcgcggcgccatcgacttcaccagtaccggcgcgacgatatcggggccgagcgccttg
gccgaggcgggcgtcgcgctggccgacatcgattatgcgtcgatctacgattccttcacg
atcaccgtcatcatgacgctggaagacctcggcttctgcaagaagggggagggcggtgcg
ttcgtcgccagcggcgcgctgcgccgcgacggtgccattcccgtcaacaccgacggcggc
gggctgtgcaacaaccatcccggctatcagggcggtatggtcaagatcgtcgaggcggtg
cggcagctgcgcggcgaggcccatgccgaaacgcaggtgcgcgactgcgaactggcgatc
gcgcacggcaccggcggcggcatgtcgcggcaagccagcgtctcgctgatactcggacgg
gaggacgcatga

DBGET integrated database retrieval system