KEGG   Sporomusa termitida: SPTER_24580Help
Entry
SPTER_24580       CDS       T06115                                 

Gene name
ahpF_1
Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
sted  Sporomusa termitida
Brite
KEGG Orthology (KO) [BR:sted00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SPTER_24580 (ahpF_1)
Enzymes [BR:sted01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     SPTER_24580 (ahpF_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 FAD_binding_2 GIDA HI0933_like FAD_oxidored Pyr_redox NAD_binding_9 Thi4 Lycopene_cycl K_oxygenase NAD_binding_8 FMO-like AlaDh_PNT_C NAD_binding_7 DAO Trp_halogenase FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: QDR81102
UniProt: A0A517DUR7
LinkDB All DBs
Position
complement(2574755..2575678)
Genome map
AA seq 307 aa AA seqDB search
MYELIIIGGGPAGMTAAVYAARKQMKALMVMKEFGGQPMWTMDIENYMGYQFVTGPELMA
KFDEQVQKFPIDIKYEEVTALAVLPDGSFTVTSDGGEYQAKTVIVASGKRPRRLEVPGEL
EFTGRGVSYCATCDGPLFAGKAVAVIGGGNSALQAAIEVSKVAAKVYLISLMNDYKADPI
IIEKLKALQQPVTELIGYTTKAVKGSQAVEKLVIVKNGDSNEIELAVQGVFVEIGLMPNS
EYCEGLLAFNEDREVIADCRTRTNIPGLFAAGDVNNGPDKQIVIAAGDGAKAALVAYEYL
LHRRRAD
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
ttgtatgagctgatcattattggcggggggccggcgggaatgacggcggccgtgtatgca
gcgcgcaagcagatgaaggccctgatggtgatgaaagagtttggcggccagccgatgtgg
acgatggatattgagaactatatgggctatcagtttgttaccggtccggaactgatggcg
aagtttgatgagcaggtgcaaaaatttcccattgatataaaatatgaggaagttacggcg
cttgctgttctgcctgacggcagctttaccgtcaccagcgatggcggcgaatatcaggct
aaaaccgtcattgtggcttcaggcaagcggcctcgccgcctggaagtgcccggagaactc
gagttcacgggccggggtgtcagttattgcgctacttgtgatggcccgctgtttgcgggt
aaggctgtagccgtcattggcggcggcaactcggccctgcaggcggcgattgaggtcagt
aaggtcgcggctaaggtatatctcatctccttaatgaacgattataaggccgatccgatc
attattgaaaaactgaaagcattacaacaaccggttaccgagcttataggctatacaact
aaggctgttaaaggctcacaggctgtggaaaagctggttattgtgaaaaatggtgacagt
aatgaaatcgaacttgcggtacagggtgtattcgtggagatcggcttaatgcctaactcg
gaatattgtgaggggctgctggcttttaatgaagaccgggaagtgattgccgattgccgc
acgcgcaccaatattccgggtttgtttgccgccggtgatgtcaataacggccctgacaag
caaattgtcatagctgccggtgacggtgcgaaagcggccctggttgcctatgaatacctg
ctgcataggcgcagagccgattag

DBGET integrated database retrieval system