KEGG   Streptococcus salivarius JIM8777: SALIVA_1726
Entry
SALIVA_1726       CDS       T02089                                 

Gene name
pfl
Definition
(GenBank) formate acetyltransferase (Pyruvate formate-lyase)
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
stj  Streptococcus salivarius JIM8777
Pathway
stj00620  Pyruvate metabolism
stj00640  Propanoate metabolism
stj00650  Butanoate metabolism
stj01100  Metabolic pathways
stj01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:stj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SALIVA_1726 (pfl)
   00640 Propanoate metabolism
    SALIVA_1726 (pfl)
   00650 Butanoate metabolism
    SALIVA_1726 (pfl)
Enzymes [BR:stj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     SALIVA_1726 (pfl)
SSDB
Motif
Pfam: PFL-like Gly_radical DUF5686
Other DBs
NCBI-ProteinID: CCB96030
LinkDB
Position
1869745..1872057
AA seq 770 aa
MATVKTNTDVFEKAWEGFKGTDWKEKASVSRFVQANYTPYDGDESFLAGPTERSLKIKKI
VDETKAGYEAEGRFPMDTRPTSIADIDAGYISKEDELIYGIQNDELFKLNFMPKGGIRMA
ETALKEHGYEPDPAVHEIFTKYVTTVNDGIFRAYTSNIRRARHAHTVTGLPDAYSRGRII
GVYARLALYGADYLMQEKVNDWNAIKEIDEETIRLREEVNLQYQALQDVVRLGDLYGVDV
RRPAFDTKEAIQWTNIAFMAVCRVINGAATSLGRVPIVLDVYAERDLARGTYTESEIQEF
VDDFVMKLRTVKFARTKAYDQLYSGDPTFITTSMAGMGADGRHRVTKMDYRFLNTLDNIG
NSPEPNLTVLWTDKLPYSFRRYCMHMSHKHSSIQYEGVTTMAKDGYGEMSCISCCVSPLD
PENEEQRHNIQYFGARVNVLKALLTGLNGGYDDVHKDYKVFDIDPIRDEVLDFDTVKANF
EKSLDWLTDTYVDALNIIHYMTDKYNYEAVQMAFLPTKQRANMGFGICGFANTVDTLSAI
KYATVKPIRDEDGYIYDYETIGEYPRWGEDDPRSNELAEWLIEAYTTRLRSHKLYKDAEA
TVSLLTITSNVAYSKQTGNSPVHKGVYLNEDGSVNLSKLEFFSPGANPSNKAKGGWLQNL
NSLASLDFGYAADGISLTTQVSPRALGKTHDEQVDNLVTILDGYFENGGQHVNLNVMDLS
DVYEKIMSGEDVIVRISGYCVNTKYLTPEQKTELTQRVFHEVLSMDDALG
NT seq 2313 nt   +upstreamnt  +downstreamnt
atggcaacggttaaaaccaacacagatgtttttgaaaaagcgtgggaaggctttaaagga
actgactggaaagaaaaagctagcgtttcacgtttcgttcaagcaaactacacaccttat
gatggtgacgaaagcttccttgcaggaccaactgaacgctctctaaaaattaaaaaaatc
gtagatgaaactaaagcaggctatgaagctgaaggacgcttcccaatggatactcgtcca
acttcaatcgctgacattgacgcaggatacatttcaaaagaagatgaacttatctatggt
atccaaaatgatgagctctttaaattgaacttcatgcctaaaggtggtatccgtatggcg
gaaactgctttgaaagaacacggttatgaaccagacccagctgtacacgaaattttcaca
aaatacgtgactacagttaacgatggtatcttccgtgcttacacttcaaacatccgtcgt
gcacgtcacgctcacacagttactggtcttccagatgcttactcacgtggacgtatcatc
ggggtttacgctcgtcttgccctctacggtgctgactacttgatgcaagaaaaagttaac
gactggaatgctatcaaagaaatcgacgaagaaactatccgtcttcgtgaagaagttaac
cttcaataccaagcacttcaagacgttgttcgccttggtgacctttatggtgtagatgtt
cgtcgtccagccttcgatactaaagaagctatccaatggacaaacattgctttcatggca
gtatgtcgtgtaatcaacggtgccgctacttcacttggtcgtgtgccaatcgtccttgac
gtatacgcagaacgtgaccttgctcgtggtacttacactgaatcagaaatccaagaattc
gttgatgatttcgttatgaaacttcgtacagttaagtttgctcgtacaaaagcttacgac
caattgtactcaggtgacccaacattcatcacaacttctatggctggtatgggtgctgac
ggacgtcaccgtgttactaagatggactaccgtttcttgaacactcttgataacatcggt
aactctccagaaccaaacttgacagttctttggactgacaaattgccttactcattccgt
cgctactgtatgcacatgagccacaaacactcttctatccaatacgaaggtgtaactact
atggctaaagacggatacggtgaaatgagctgtatctcatgttgtgtatcaccacttgac
ccagaaaacgaagaacaacgtcacaacatccaatacttcggtgctcgtgttaacgtactt
aaagcccttcttactggtttgaacggtggttacgacgatgttcataaagactacaaagta
tttgatatcgatccaatccgtgatgaagttcttgactttgacactgttaaagctaacttc
gaaaaatctcttgactggttgactgacacttacgtagatgcccttaacatcatccactac
atgactgataagtacaactatgaagctgttcaaatggccttcttgccaactaaacaacgt
gctaacatgggattcggtatctgtggtttcgcaaatactgttgatacattgtcagcaatc
aaatacgctacagttaaaccaatccgtgacgaagatggctacatctacgactacgaaaca
atcggtgaatacccacgttggggtgaagatgacccacgttcaaacgaattggcagaatgg
ttgattgaagcttacactactcgtcttcgtagccacaaactctacaaagatgcagaagct
acagtttcacttcttacaatcacttctaacgttgcttactctaaacaaactggtaactct
ccagttcacaaaggggtatacctcaacgaagatggttcagtgaacttgtctaaattggaa
ttcttctcaccaggtgctaacccatctaacaaagctaaaggtggatggttgcaaaacttg
aactcacttgcaagccttgacttcggttatgcagctgacggtatctcacttactactcaa
gtatcgcctcgtgcccttggtaagactcacgacgaacaagttgacaacctcgtaactatc
cttgacggatacttcgaaaacggtggacaacacgttaacttgaacgttatggacttgtca
gacgtttacgaaaagattatgagcggtgaagatgttatcgtacgtatctctggatattgt
gtaaacactaaatacctcactccagaacaaaaaactgaattgacacaacgtgtcttccac
gaagttctttcaatggacgacgctttgggataa

DBGET integrated database retrieval system