KEGG   Streptococcus salivarius JIM8777: SALIVA_1940
Entry
SALIVA_1940       CDS       T02089                                 

Gene name
ilvH
Definition
(GenBank) acetolactate synthase small subunit (Acetohydroxy-acid synthase small subunit) (AHAS) (ALS)
  KO
K01653  acetolactate synthase I/III small subunit [EC:2.2.1.6]
Organism
stj  Streptococcus salivarius JIM8777
Pathway
stj00290  Valine, leucine and isoleucine biosynthesis
stj00650  Butanoate metabolism
stj00660  C5-Branched dibasic acid metabolism
stj00770  Pantothenate and CoA biosynthesis
stj01100  Metabolic pathways
stj01110  Biosynthesis of secondary metabolites
stj01210  2-Oxocarboxylic acid metabolism
stj01230  Biosynthesis of amino acids
Module
stj_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
stj_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:stj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SALIVA_1940 (ilvH)
   00660 C5-Branched dibasic acid metabolism
    SALIVA_1940 (ilvH)
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    SALIVA_1940 (ilvH)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    SALIVA_1940 (ilvH)
Enzymes [BR:stj01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     SALIVA_1940 (ilvH)
SSDB
Motif
Pfam: ALS_ss_C ACT ACT_5 ACT_4 ACT_6 DUF5301 Saccharop_dh_N
Other DBs
NCBI-ProteinID: CCB96235
LinkDB
Position
complement(2077344..2077811)
AA seq 155 aa
MLTAKLQNRSGVLNRFTGVLSRRQVNIESISVGASEDPNVSRITIIIDVNSQNEVEQIIK
QLNRQIDVIRIRDITDQPHLEREVILVKVSAPTSKRAEILAIIQPFRASVVDVAPSSITI
QMTGDAEKSEALLRVIRPYGIKNIARTGATGFTRD
NT seq 468 nt   +upstreamnt  +downstreamnt
atgttaacagctaaacttcagaaccgttcgggtgtccttaaccgcttcacaggtgttctt
tcacgacgtcaagttaatattgaaagtatatctgtaggggcttctgaggatcctaacgtt
tcacgtattacgattattattgatgtgaattctcaaaatgaagtggaacaaatcatcaaa
cagcttaatcgtcagattgatgtgattcgtatccgtgatatcacggatcagccacacttg
gaacgtgaagttatcctagttaaggtatcagcaccaacctctaagcgtgctgaaatcttg
gcgattattcaacctttccgtgcttcggtagttgatgtggcaccaagctctatcactatc
cagatgactggtgatgctgaaaagagcgaggcgcttctacgagttattcgtccttacgga
atcaagaatatcgctcgtacgggtgctactggatttacccgtgattaa

DBGET integrated database retrieval system