KEGG   Streptococcus parauberis: STP_0953Help
Entry
STP_0953          CDS       T01504                                 

Definition
(GenBank) pyruvate dehydrogenase E1 component, beta subunit
  KO
K00162  pyruvate dehydrogenase E1 component beta subunit [EC:1.2.4.1]
Organism
stk  Streptococcus parauberis
Pathway
stk00010  Glycolysis / Gluconeogenesis
stk00020  Citrate cycle (TCA cycle)
stk00620  Pyruvate metabolism
stk01100  Metabolic pathways
stk01110  Biosynthesis of secondary metabolites
stk01120  Microbial metabolism in diverse environments
stk01130  Biosynthesis of antibiotics
stk01200  Carbon metabolism
Module
stk_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:stk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STP_0953
   00020 Citrate cycle (TCA cycle)
    STP_0953
   00620 Pyruvate metabolism
    STP_0953
Enzymes [BR:stk01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     STP_0953
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr Transketolase_C PFOR_II
Motif
Other DBs
NCBI-ProteinID: AEF25401
LinkDB All DBs
Position
complement(1013293..1014291)
Genome map
AA seq 332 aa AA seqDB search
MSETKLMALREAVNLAMSEEMRKDENIFLMGEDVGVYGGDFGTSVGMIEEFGAKRVKDTP
ISEAAISGAAIGAAITGLRPIVDVTFMDFLTIMMDAIVNNGAKNNYMFGGGLKTPVTFRV
ASGSGIGSAAQHSQSLEAWMTHIPGIKVVAPGNANDAKGLLKSAIQDNNIVIFMEPKSLY
GKKEEVNQDPEFYIPLGKGEIKREGTDLTIISYGRMLERVLQAAEEVAEEGINVEVLDPR
TLVPLDKELIIESVKKTGRVMLVNDAYKTGGYIGEIATMITESEAFDYLDHPVVRLASED
VPVPYARILEQAILPDVEKIKAAIVKMAKKGN
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaacaaaattaatggctttgcgtgaagccgtaaatcttgccatgtcagaagaa
atgcgcaaagatgaaaacatcttccttatgggtgaagatgttggtgtatatggtggtgac
tttggtacatcagttggtatgattgaagaatttggtgctaaacgtgttaaagacacacca
atttcagaagctgccatttctggtgctgctattggtgctgcaattacaggtttacgtcca
attgttgacgtaacgttcatggacttccttacaatcatgatggacgctattgttaacaat
ggtgcgaaaaataactacatgtttggtggcggacttaaaacacctgtaactttccgtgtt
gcttctggatctggtatcggatctgctgctcaacactcacaatctttagaagcttggatg
acacatattccaggtatcaaagttgttgcaccaggaaatgcaaatgatgctaaaggtctt
ttgaaatcagcaatccaagataataacattgttatcttcatggaaccaaaatctttgtat
ggtaaaaaagaagaagttaatcaagatcctgaattctatattccattaggaaaaggtgaa
atcaaacgtgaaggtactgatttaacaatcatatcctatggtcgtatgttagaacgtgtt
cttcaggctgctgaagaagttgctgaagaaggaatcaacgttgaagttcttgacccccgt
acacttgtacctctagataaagaattgattattgaatctgttaagaaaactggtcgtgta
atgcttgtcaatgacgcatacaaaactggtggttacatcggtgaaattgcaactatgatt
actgaaagtgaagcatttgactatcttgatcatccagtagtacgtctagctagtgaagat
gtgccagttccttatgcacgtattcttgaacaggctatcttaccagatgttgaaaaaatc
aaagctgctattgtaaaaatggcaaaaaaaggtaactaa

DBGET integrated database retrieval system