KEGG   Sebaldella termitidis: Sterm_3384
Entry
Sterm_3384        CDS       T01123                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
str  Sebaldella termitidis
Pathway
str00052  Galactose metabolism
str01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:str00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Sterm_3384
Enzymes [BR:str01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     Sterm_3384
SSDB
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C ADH_zinc_N_2 2-Hacid_dh_C Glu_dehyd_C 3HCDH_N Shikimate_DH NAD_binding_2 GFO_IDH_MocA MTS CoA_binding Methyltransf_25
Other DBs
NCBI-ProteinID: ACZ10223
UniProt: D1AQG3
LinkDB
Position
complement(3570514..3571551)
AA seq 345 aa
MKALAVLENEKLGVIDLEKPENTTGDDVLVKVVYSGLCGSDFPRMFEHQAKFFPVVLGHE
FSGVVEKVGEKVHKLAVGDKVSCIPLKPCFKCEACDEGNYSLCKNYGFIGSRENGGMEEY
VKIPEINLQKLPEKFDLLQGAFFEPITVVLHGLGLLNKEVKGKKVGIIGVGTMGLLAVQC
AKAYGAELVSAFDINEKNLEAAKELGADEVHNVAKKDIENEYDKYDIMIETSGANPSFVL
ILKLAAGKGELLYIGTPHSTLTFEYKDFELINRKELTIKGSWMNYSKPFPGKEWTEAIRL
FDEGLVKIDKLIGATVSMEEFCERLEEIKGRTLGGKIMVKVGESE
NT seq 1038 nt   +upstreamnt  +downstreamnt
ttgaaagcattagcagtattggaaaatgaaaaactcggggtaattgatttagagaaaccg
gaaaatacaaccggtgatgatgtattggtaaaggtagtgtattcaggactttgcggttcg
gattttccgagaatgtttgagcatcaggcaaaattttttcctgtagttttgggtcatgag
ttttcaggagtagtggaaaaagttggtgaaaaagttcataaactggcagtcggggacaaa
gtaagctgtattccgttaaaaccttgttttaaatgtgaagcatgtgatgaagggaattat
tctctgtgtaaaaattatggatttatcggttcgagagaaaacggcggaatggaagaatat
gtaaaaatacctgaaataaatcttcaaaaacttccggaaaaatttgatctgcttcagggt
gcattttttgagcctataacagttgtattacacggacttggtcttttgaataaagaggta
aaaggtaaaaaagtggggattatcggagtgggaacaatggggcttctggcagttcagtgt
gcgaaagcatatggagcagagctggtttcagcctttgatataaatgaaaaaaatcttgaa
gctgcgaaagaactgggggcagacgaagtacataatgtagctaaaaaagatatagagaat
gaatacgataaatatgatataatgatagaaacatcaggagcgaatccgagttttgtatta
attctaaaacttgccgcaggaaaaggagagcttttatacataggaactccgcatagtaca
ctgacatttgaatataaggattttgaattaataaacagaaaagaacttacaataaaaggt
tcatggatgaattattccaagccgtttccgggaaaagagtggacagaggcaataagactt
tttgatgagggtcttgttaagattgataaattaatcggagccactgtttctatggaagaa
ttctgtgagagactggaagagataaaagggagaacattaggaggaaaaattatggtaaag
gtaggagaaagcgaatga

DBGET integrated database retrieval system