KEGG   Streptomyces sp. CCM_MD2014: NI25_15050Help
Entry
NI25_15050        CDS       T04862                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
strd  Streptomyces sp. CCM_MD2014
Pathway
strd00564  Glycerophospholipid metabolism
strd01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:strd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    NI25_15050
Enzymes [BR:strd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     NI25_15050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 FAD_binding_2 FAD_oxidored Pyr_redox_2 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AIV34656
UniProt: A0A0N6ZLQ5
LinkDB All DBs
Position
complement(3508505..3510211)
Genome map
AA seq 568 aa AA seqDB search
MRTATLGPAQRAESLAAMAERELDVLVVGAGVVGAGTALDAVTRGLSVGLVEARDWASGT
SSRSSKLIHGGLRYLEMLDFVLVREALKERGLLLERLAPHLVKPVPFLYPLQHKGWERLY
AGSGVALYDAMSMARGHGRGLPLHRHLTRRHALRVAPALKKDALVGALQYYDAQMDDARF
VATLVRTAAAYGAKAANRARVTSFLREGERVVGARVRDVEAGGEYEVRAKQVVNATGVWT
DDTQAMVGERGQFHVRASKGIHLVVPKDRIHSSTGLILRTEKSVLFVIPWGRHWIIGTTD
TDWDLDKAHPAASSADIDYLLEHVNSVLSVPLTRDDVEGVYAGLRPLLAGESDATSKLSR
EHTVAHPVPGLVVVAGGKYTTYRVMAKDAVDEAVHGLDLRVADCVTEETPLLGAEGYHAL
WNARARIAARTGLHVVRVEHLLNRYGALTEELLELVAADPSLGEPLTGADDYLRAEVVYA
ASHEGARHLDDVLTRRTRISIETFDRGTQCAREVAELMAPVLGWDKGQVEREIQHYEKRV
EAERESQRQPDDLTADAARLGAPDIVAR
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
gtgaggacagcgacccttgggccggcgcagcgcgccgagtcgctcgccgccatggccgag
cgcgagctcgacgtactggtggtgggcgccggcgtggtcggtgcgggcaccgcactcgac
gccgtgacgcgcggcctgtccgtcggcctggtcgaggcgcgggactgggcctcgggcacc
tccagcaggtccagcaagctgatccacggcgggctgcgctatctggagatgctcgacttc
gtgctcgtgcgggaggcgctgaaggagcgcggactgctgctcgaacggctggcgccgcac
ctggtgaagccggtgcccttcctgtacccgctccagcacaagggctgggagcggctgtac
gcgggctccggcgtcgcgctctacgacgccatgtccatggcccgcggccacggccggggg
ctgccgctgcaccggcacctgacccggcgtcacgccctgcgcgtggcacccgcgctgaag
aaggacgcgctggtcggcgcgctgcagtactacgacgcccagatggacgacgcccgcttc
gtggccacgctggtgcgcaccgcggcggcgtacggcgccaaggccgccaaccgggcccgg
gtcacctccttcctgcgcgagggcgaacgggtggtcggcgcgcgggtgcgggacgtcgag
gcgggcggcgagtacgaggtccgcgccaagcaggtggtcaacgcgaccggggtgtggacc
gacgacacccaggcgatggtgggcgagcgcggccagttccacgtccgggcctccaagggc
atccacctggtcgtgcccaaggaccgcatccactccagcaccgggctgatcctgcgcacc
gagaagtccgtgctgttcgtcatcccctggggccggcactggatcatcggcaccacggac
accgactgggacctcgacaaggcccacccggccgcctccagcgccgacatcgactacctg
ctggaacacgtcaactcggtgctgtcggtgcctctcacgcgcgacgacgtcgagggcgtg
tacgccgggctgcgcccgctgctggccggcgagtcggacgccaccagcaagctgtcgcgc
gagcacaccgtcgcccatcccgtgcccggcctggtcgtcgtggcgggcggcaagtacacg
acgtaccgggtgatggccaaggacgccgtggacgaggccgtgcacggactcgacctgcgg
gtcgccgactgcgtcaccgaggagaccccgctgctgggcgccgagggctaccacgcgctg
tggaacgcgcgggcccggatcgccgcccgcaccggactgcacgtcgtacgcgtggagcat
ctgctgaaccgttacggcgcgttgacggaggagctgctcgaactcgtcgccgccgatccc
tccctgggcgagcccctcaccggcgccgacgactacctgcgcgccgaggtcgtctacgcc
gcatcccacgagggcgcgcggcacctcgacgacgtactcacccggcgcacccgcatctcc
atcgagaccttcgaccggggaacgcagtgcgcccgcgaggtcgccgagctgatggcaccg
gtcctcggctgggacaagggccaggtcgaacgggagatccagcactacgagaagcgggtc
gaggccgagcgcgagtcgcagcgccagcccgacgacctgacggccgacgcggcccggctg
ggggcgccggacatcgtggcgcggtaa

DBGET integrated database retrieval system