KEGG   Streptomyces sp. 769: GZL_02272Help
Entry
GZL_02272         CDS       T03587                                 

Definition
(GenBank) neuraminidase
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
stre  Streptomyces sp. 769
Pathway
stre00511  Other glycan degradation
stre00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:stre00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    GZL_02272
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    GZL_02272
Enzymes [BR:stre01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     GZL_02272
Bacterial toxins [BR:stre02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   GZL_02272
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_2 Laminin_G_3 BNR_3 BNR DUF4185 Laminin_G_2 Laminin_G_1
Motif
Other DBs
NCBI-ProteinID: AJC54865
UniProt: A0A0A8EF62
LinkDB All DBs
Position
2386116..2388077
Genome map
AA seq 653 aa AA seqDB search
MPRRAGRTMTSDLRAHPRLRRRPRHRRAQAAAVALAATALAALATAPARAAADAPSGGFD
QQVLFKAAHEKGYFCFRIPAIVRTVRGTLLAFAEGRVHDCGDAGDIDLVLKRSTDGGRTW
GRLQVVNHGDGDTHGNPAPLVDRRTGRIILAETYNKGRTDGLSCDVPCDRTPHLQYSDDD
GATWSAPRDLTRSIRPRRWNSWYATGPVHGIQLAHGRHAGRLVFGVNAESYTGARITANH
AALVHSDDGGTTWRVGALDTWPIAPDGTFRQKPSEMTLLERSDGSIYVNGREQDGTDLGN
RTATVSRDGGDSFTAPFRTIPDLYTPMVQASALRLPRSSGDGGHGRTLLAAPADPDRRRT
MTIRSSYDEGRTWEGVDRGARVSADWSGYSDLVAVSPTVTGLLYEGGTADARDEIRFARF
TEQWLGPRRGPDPTTPDRAPGARPALVLGGARLTDGPFGRALSFDGTDDAVRLPYRDSLP
LGSRDFTCALWFRYRAAAGEQPLLWMGGVGSSSPQVALAGDPAHHRITALLTAVDGARAP
ATAKVATAGAYNDGDWHHLALRRAGGRLLLTVDGTATTSAADVPGSVSRTSVFGVHLGQR
PDGRAQFTGALAQVRVYRRALTDAELSRVRERNASAAGPLVLGLPLDRVDADR
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgaagggcaggccggaccatgacgtcagatctccgcgcgcacccccgcctccgc
cgcagaccccggcaccgccgtgcccaggccgccgccgtcgcgctggccgccaccgccctc
gccgccctggccacggctccggcccgggccgccgctgacgccccttcaggcggcttcgac
cagcaggtgctgttcaaggcggcgcacgagaagggctacttctgcttccgtatacccgcc
atcgtgcggaccgtccgcggcaccctcctcgccttcgccgagggccgggtgcacgactgc
ggggacgccggcgacatcgacctcgtcctcaagcgctccaccgacggcggccggacctgg
ggccgcctccaggtcgtcaaccacggcgacggggacacccacgggaacccggcgcccctg
gtggaccgccgcaccggccgcatcatcctcgccgagacctacaacaagggccgtaccgac
ggcctcagttgcgacgtcccctgcgaccgcaccccgcatctccagtacagcgacgacgac
ggcgccacctggtccgcaccccgcgacctgacccgcagcatccgcccccgccggtggaac
tcctggtacgccaccggcccggtgcacggcatccagctcgcccacggacggcacgccggg
cggctggtcttcggcgtcaacgccgagagctacacgggcgcccggatcaccgccaaccac
gccgcgctcgtccacagcgacgacggcggcaccacatggcgggtgggtgcgttggacacc
tggccgatcgccccggacggaaccttccgacagaagccgtccgagatgaccctcctggag
cgctccgacggctcgatctacgtcaacggccgcgaacaggacggcaccgacctcggcaac
cgcaccgccacggtgagccgggacggcggcgactccttcaccgcgccgttccgcacgatc
cccgacctctacaccccgatggtgcaggcgtccgcgctgcggctgccgcgctcgtccggc
gacggcggccacggccgcaccctgttggccgcgccggccgacccggaccgccgccgcacc
atgaccatccgctcctcgtacgacgagggccgcacctgggagggcgtggaccggggcgcc
cgggtcagcgccgactggtccggctactccgacctggtcgccgtctcccccaccgtcacc
ggcctgctctacgagggcggcaccgccgacgcccgggacgagatccgcttcgcccgcttc
accgagcagtggctcggaccgcgccgcggcccggacccgaccacccccgaccgggccccc
ggcgcccggccggccctggtcctgggcggcgcccggctcaccgacggccccttcggccgc
gccctgtccttcgacggcaccgacgacgccgtccgcctcccctaccgcgactcgctcccg
ctgggcagccgggacttcacctgcgccctgtggttccgctaccgcgccgccgccggcgag
cagccgctgctgtggatgggcggggtgggcagcagctccccgcaggtcgcccttgcgggc
gatcccgcgcaccaccggatcaccgcgctcctcacggccgtcgacggcgcccgggcgccc
gccaccgccaaggtcgccaccgccggcgcgtacaacgacggcgactggcaccacctcgcg
ctgcgccgcgccggcggccggctgctgctgaccgtcgacggcaccgcgacgacctcggcc
gcggacgttcccggatcggtcagccgcacctcggtgttcggcgttcacctgggccaacgg
ccggacggccgggcgcagttcaccggtgccctggcgcaggtgcgcgtctaccgccgggcg
ctcaccgacgccgaactctcccgggtccgcgagcgcaacgcctcagcggccggcccgctg
gtgctcggactcccgctggaccgggtcgacgccgaccgctga

DBGET integrated database retrieval system