KEGG   Streptomyces sp. 4F: ASR50_14935Help
Entry
ASR50_14935       CDS       T04265                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
strf  Streptomyces sp. 4F
Pathway
strf00250  Alanine, aspartate and glutamate metabolism
strf00650  Butanoate metabolism
strf01100  Metabolic pathways
strf01110  Biosynthesis of secondary metabolites
strf01120  Microbial metabolism in diverse environments
strf02024  Quorum sensing
Module
strf_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:strf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    ASR50_14935
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ASR50_14935
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ASR50_14935
   00430 Taurine and hypotaurine metabolism
    ASR50_14935
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ASR50_14935
Enzymes [BR:strf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     ASR50_14935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: ALV50579
UniProt: A0A0U3Q255
LinkDB All DBs
Position
3382136..3383545
Genome map
AA seq 469 aa AA seqDB search
MPLHPGRPAGERPMSVNPFLGPANPVGGMTQAPPRHRLPDGPMAPSTAYQLVHDELMLDG
NARLNLATFVTTWMEPEAGVLMMECRDKNMIDKDEYPRTAELERRCVAMLADLWHAPDPS
KAVGCSTTGSSEACMLAGLAMKRRWALRNAGRYPSREARPNLVMGINVQVCWDKFCTFFE
VEPRQVPMEGDRFHLDPAAAAELCDENTIGVVGILGSTFDGSYEPVAELCAALDDLQERT
GLDVPVHVDGASGAMVAPFLDEDLVWDFRLDRVASVNTSGHKYGLVYPGVGWVLWRDAAA
LPEELVFRVNYLGGDMPTFALNFSRPGAQVVAQYYSFLRLGRDGYRAVQQAARDVATGLS
ARIEALGDFRLLTRGDELPVFAFTTAPDVTAFDVFDVARRLRETGWLVPAYTFPANRQDL
AVLRVVCRNGFSEDLADLFAEDLTRLLPDLRSQSHPLTRDRNAATGFHH
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgccgctgcaccccggccggccggccggtgagcgcccgatgtccgtcaaccccttcctg
gggcccgcgaacccggtcggggggatgacccaggcgccacccaggcaccggctgccggac
ggccccatggccccgtcgacggcgtaccagctggtgcacgacgagctgatgctggacggc
aacgcccggctgaacctggccaccttcgtcaccacctggatggagcccgaggccggggtg
ctgatgatggagtgccgcgacaagaacatgatcgacaaggacgagtacccgcgcaccgcc
gaactggagcggcggtgcgtggcgatgctcgccgacctgtggcacgcgcccgacccgtcg
aaggcggtgggctgttcgaccaccggttccagcgaggcgtgcatgctggccgggctggcc
atgaagcggcgctgggcgctgcgcaacgccggccgctacccctcgcgggaggcccgcccg
aacctggtgatgggcatcaacgtccaggtgtgctgggacaagttctgcaccttcttcgag
gtggagccccgtcaggtgccgatggagggcgaccgtttccacctcgacccggcggcggcc
gcggagctgtgcgacgagaacaccatcggcgtcgtcggcatcctcggctccaccttcgac
gggtcctacgagcctgtcgccgagctgtgcgcggccctggacgacctccaggagcgcacg
ggcctggacgtcccggtgcacgtcgacggggcgtcgggggcgatggtcgcgccgttcctc
gacgaggacctggtgtgggacttccggctggaccgggtggcgtcggtcaacacctccggg
cacaagtacggcctggtgtacccgggggtgggctgggtgctgtggcgggacgcggcggcg
ctgcccgaggagctggtgttccgggtgaactacctgggcggcgacatgccgaccttcgcg
ctgaacttctcccggccgggcgcccaggtggtggcgcagtactactccttcctgcggctg
ggccgggacggctaccgcgcggtgcagcaggccgcgcgggacgtggccacgggactgtcc
gcgcggatcgaggcgctcggcgacttccggctgctcacccggggcgacgagctgccggtg
ttcgccttcaccacggcgccggacgtgacggcgttcgacgtgttcgacgtggcgcggcgg
ctgcgggagaccggctggctggtgcccgcctacaccttcccggcgaaccgtcaggacctc
gcggtgctgcgggtggtgtgccgcaacggcttctccgaggacctcgccgacctgttcgcc
gaggacctcacccggctgctgccggacctgcggagccagtcacaccccctcacgcgggac
aggaacgcggcgaccggcttccatcactga

DBGET integrated database retrieval system