KEGG   Streptomyces sp. 4F: ASR50_14935Help
Entry
ASR50_14935       CDS       T04265                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
strf  Streptomyces sp. 4F
Pathway
strf00250  Alanine, aspartate and glutamate metabolism
strf00410  beta-Alanine metabolism
strf00430  Taurine and hypotaurine metabolism
strf00650  Butanoate metabolism
strf01100  Metabolic pathways
strf01110  Biosynthesis of secondary metabolites
strf01120  Microbial metabolism in diverse environments
strf02024  Quorum sensing
Module
strf_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:strf00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    ASR50_14935
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ASR50_14935
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ASR50_14935
   00430 Taurine and hypotaurine metabolism
    ASR50_14935
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    ASR50_14935
Enzymes [BR:strf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     ASR50_14935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: ALV50579
UniProt: A0A0U3Q255
LinkDB All DBs
Position
3382136..3383545
Genome map
AA seq 469 aa AA seqDB search
MPLHPGRPAGERPMSVNPFLGPANPVGGMTQAPPRHRLPDGPMAPSTAYQLVHDELMLDG
NARLNLATFVTTWMEPEAGVLMMECRDKNMIDKDEYPRTAELERRCVAMLADLWHAPDPS
KAVGCSTTGSSEACMLAGLAMKRRWALRNAGRYPSREARPNLVMGINVQVCWDKFCTFFE
VEPRQVPMEGDRFHLDPAAAAELCDENTIGVVGILGSTFDGSYEPVAELCAALDDLQERT
GLDVPVHVDGASGAMVAPFLDEDLVWDFRLDRVASVNTSGHKYGLVYPGVGWVLWRDAAA
LPEELVFRVNYLGGDMPTFALNFSRPGAQVVAQYYSFLRLGRDGYRAVQQAARDVATGLS
ARIEALGDFRLLTRGDELPVFAFTTAPDVTAFDVFDVARRLRETGWLVPAYTFPANRQDL
AVLRVVCRNGFSEDLADLFAEDLTRLLPDLRSQSHPLTRDRNAATGFHH
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgccgctgcaccccggccggccggccggtgagcgcccgatgtccgtcaaccccttcctg
gggcccgcgaacccggtcggggggatgacccaggcgccacccaggcaccggctgccggac
ggccccatggccccgtcgacggcgtaccagctggtgcacgacgagctgatgctggacggc
aacgcccggctgaacctggccaccttcgtcaccacctggatggagcccgaggccggggtg
ctgatgatggagtgccgcgacaagaacatgatcgacaaggacgagtacccgcgcaccgcc
gaactggagcggcggtgcgtggcgatgctcgccgacctgtggcacgcgcccgacccgtcg
aaggcggtgggctgttcgaccaccggttccagcgaggcgtgcatgctggccgggctggcc
atgaagcggcgctgggcgctgcgcaacgccggccgctacccctcgcgggaggcccgcccg
aacctggtgatgggcatcaacgtccaggtgtgctgggacaagttctgcaccttcttcgag
gtggagccccgtcaggtgccgatggagggcgaccgtttccacctcgacccggcggcggcc
gcggagctgtgcgacgagaacaccatcggcgtcgtcggcatcctcggctccaccttcgac
gggtcctacgagcctgtcgccgagctgtgcgcggccctggacgacctccaggagcgcacg
ggcctggacgtcccggtgcacgtcgacggggcgtcgggggcgatggtcgcgccgttcctc
gacgaggacctggtgtgggacttccggctggaccgggtggcgtcggtcaacacctccggg
cacaagtacggcctggtgtacccgggggtgggctgggtgctgtggcgggacgcggcggcg
ctgcccgaggagctggtgttccgggtgaactacctgggcggcgacatgccgaccttcgcg
ctgaacttctcccggccgggcgcccaggtggtggcgcagtactactccttcctgcggctg
ggccgggacggctaccgcgcggtgcagcaggccgcgcgggacgtggccacgggactgtcc
gcgcggatcgaggcgctcggcgacttccggctgctcacccggggcgacgagctgccggtg
ttcgccttcaccacggcgccggacgtgacggcgttcgacgtgttcgacgtggcgcggcgg
ctgcgggagaccggctggctggtgcccgcctacaccttcccggcgaaccgtcaggacctc
gcggtgctgcgggtggtgtgccgcaacggcttctccgaggacctcgccgacctgttcgcc
gaggacctcacccggctgctgccggacctgcggagccagtcacaccccctcacgcgggac
aggaacgcggcgaccggcttccatcactga

DBGET integrated database retrieval system