Peterkaempfera bronchialis: C7M71_008360 Help Entry C7M71_008360      CDS       T05561                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism stri  Peterkaempfera bronchialis Pathway stri00998   Biosynthesis of various antibiotics stri01100   Metabolic pathways stri01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:stri00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     C7M71_008360   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     C7M71_008360 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  AXI77451 UniProt:  A0A345SUP6 LinkDB All DBs Position 1899827..1900069 Genome browser AA seq 80 aa AA seqDB search MATKDEVLAGLAEIVNEIAGIPTEDVELDKSFTDDLDVDSLSMVEVVVAAEERFDCKIPD DEVKNLKTVGDAVEYILANS NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggctaccaaggacgaggtcctggcaggtctcgccgagatcgtcaacgagatcgccggc atccccaccgaggacgtcgagctggacaagtccttcaccgacgacctggacgtcgactcg ctctccatggtcgaggtcgtcgtcgccgccgaggagcgcttcgactgcaagatcccggac gacgaggtgaagaacctcaagaccgtgggcgacgccgtcgagtacatcctcgccaacagc tga

DBGET integrated database retrieval system