KEGG   Streptomyces sp. Mg1: M444_21050Help
Entry
M444_21050        CDS       T03958                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
strm  Streptomyces sp. Mg1
Pathway
strm00564  Glycerophospholipid metabolism
strm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:strm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    M444_21050
Enzymes [BR:strm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     M444_21050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 FAD_binding_2 FAD_oxidored Pyr_redox_2 DUF5069 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AKL67474
UniProt: B4V4T0
LinkDB All DBs
Position
1:4829130..4830836
Genome map
AA seq 568 aa AA seqDB search
MRTAALGPVQRAEALARMAERELDVLVVGAGVVGAGTALDAVTRGLSTGLVEARDWASGT
SSRSSKLIHGGLRYLEMLDFTLVREALKERGLLLGRLAPHLVKPVPFLYPLQHRAWERFY
AGSGVALYDAMSLSSGHGRGLPVHRHLSRTQALRVAPALRKDALVGALQYYDAQMDDARY
VTTLVRTASAYGAHCANRARVVGFLREGERVVGATVRDVEGGGEYEVRAKQIVNATGVWT
DDTQALIGERGQFHVRASKGIHLVVPKDRIHSSTGLILRTEKSVLFVIPWGRHWIVGTTD
TDWDLDKAHPAASSADIDYLLEHVNSVLAVPLTRDDVQGVYAGLRPLLAGESDATSKLSR
EHTVAHPVPGLVVVAGGKYTTYRVMAKDAVDAAVHGLDQRVAECVTEEVPLVGAEGYRAL
WNGRARIAARTGIHVARVEHLLNRYGSMTEELLELIAADPGLAEPLGGAEDYLRAEVVYA
ASHEGARHLDDVLTRRTRISIETFDRGTRSAREAAELMAPVLGWDKQQIEKEVEHYEKRV
QAERESQRQPDDQTADAARLGAPDIVPL
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
gtgaggacagcggcactgggaccggtccagcgcgccgaggcgctcgcccggatggccgag
cgggagctggacgtactggtggtgggcgccggcgtggtgggagccggaaccgcgctggac
gccgtgaccagaggactgtcgaccggcctggtggaggcgcgggactgggcctcgggcacc
tccagccggtccagcaagctgatccacggcggactgcggtacctggagatgctcgacttc
accctcgtgcgggaggcgctcaaggagcgcggcctgctgctggggcggctggcgccgcac
ctggtgaagccggtgccgttcctgtacccgctccagcaccgggcctgggagcggttctac
gcgggctccggcgtcgcgctgtacgacgccatgtccctctccagcgggcacgggcgcggg
ctgccggtccaccgccacctgtcgcgcacccaggccctgcgggtggctccggcgctgcgc
aaggacgcgctggtgggggccctgcagtactacgacgcccagatggacgacgcgcggtac
gtcaccacgctggtgcggacggcctcggcgtacggggcgcactgcgccaaccgggcgagg
gtggtcgggttcctgcgcgagggcgagcgggtcgtcggcgcgacggtgcgcgacgtggag
ggcggcggggagtacgaggtccgcgcgaagcagatcgtgaacgcgacgggggtgtggacg
gatgacacccaggcgctgatcggtgagcgggggcagttccacgtacgggcgtcgaagggc
atccacctcgtcgtcccgaaggaccggatccactcctcgaccgggctgatcctgcgcacg
gagaagtcggtgctgttcgtgatcccgtggggtcggcactggatcgtggggaccaccgac
acggactgggacctggacaaggcgcatccggcggcctccagcgcggacatcgactacctg
ctggaacacgtgaactcggtgctggcggtgccgctcacgcgggacgacgtccagggggtg
tacgcgggcctgcggccgctgctcgccggcgagtcggacgcgacgagcaagctctcccgg
gagcacacggtggcgcacccggtgccggggctggtggtcgtcgcgggcggcaagtacacg
acgtaccgggtcatggctaaggacgcggtggacgcggcggtgcacgggctggaccagcgg
gtggcggagtgcgtgaccgaggaggtgccgctggtgggggcggaagggtaccgggccctg
tggaacgggcgggcccggatcgcggcgcggacgggaattcatgtggcgcgggtggagcac
ctgttgaaccggtacgggtcgatgacggaggaactgctggaactcatcgcggcggacccc
gggctggcggagccgctgggcggggcggaggactacctgcgtgccgaggtggtgtacgcg
gcctcgcacgagggggcgcgccacctggacgacgtcctgacgcggcggacgcggatctcg
atcgagacgttcgaccgggggacgcggtcggcgcgggaggctgcggagttgatggctccg
gttctgggctgggacaagcagcagatcgagaaagaagtggaacactacgagaagcgggtg
caggcggaacgggaatcccagcgtcagccggacgaccagacggcggacgcggcgcggctg
ggggcgcccgacatcgttccgttgtaa

DBGET integrated database retrieval system