KEGG   Streptomyces sp. MOE7: STRMOE7_31700Help
Entry
STRMOE7_31700     CDS       T05374                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
stro  Streptomyces sp. MOE7
Pathway
stro00071  Fatty acid degradation
stro00280  Valine, leucine and isoleucine degradation
stro00281  Geraniol degradation
stro00310  Lysine degradation
stro00362  Benzoate degradation
stro00380  Tryptophan metabolism
stro00410  beta-Alanine metabolism
stro00640  Propanoate metabolism
stro00650  Butanoate metabolism
stro00903  Limonene and pinene degradation
stro00930  Caprolactam degradation
stro01100  Metabolic pathways
stro01110  Biosynthesis of secondary metabolites
stro01120  Microbial metabolism in diverse environments
stro01130  Biosynthesis of antibiotics
stro01200  Carbon metabolism
stro01212  Fatty acid metabolism
Module
stro_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:stro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    STRMOE7_31700
   00650 Butanoate metabolism
    STRMOE7_31700
  09103 Lipid metabolism
   00071 Fatty acid degradation
    STRMOE7_31700
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    STRMOE7_31700
   00310 Lysine degradation
    STRMOE7_31700
   00380 Tryptophan metabolism
    STRMOE7_31700
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    STRMOE7_31700
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    STRMOE7_31700
   00281 Geraniol degradation
    STRMOE7_31700
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    STRMOE7_31700
   00930 Caprolactam degradation
    STRMOE7_31700
Enzymes [BR:stro01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     STRMOE7_31700
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     STRMOE7_31700
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     STRMOE7_31700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 DAO F420_oxidored Pyr_redox_2 NAD_Gly3P_dh_N Sacchrp_dh_NADP adh_short_C2 NAD_binding_8 2-Hacid_dh_C UDPG_MGDP_dh_N GIDA
Motif
Other DBs
NCBI-ProteinID: ARH94101
UniProt: A0A1W5XW47
LinkDB All DBs
Position
7216130..7218331
Genome map
AA seq 733 aa AA seqDB search
MSESAALTIRWEQDETGIVTLVLDDPGQSANTMNNAFKTSLTAVADRLEAEKDSIRGIIF
TSAKKTFFAGGDLRDLIAVTPAQAQRAFESGNGIKRDLRRIETLGKPVVAAINGAALGGG
YEIALACHHRVALDTPGTKIGLPEVTLGLLPAAGGVTRTVRLLGIADALLKVLLQGTQYS
APRAKEAGLIHDVAATPEELLAKARAFVDEHPESQQPWDVKGYRIPGGTPAQPKFAANLP
AFPANLKKQLNGAPYPAPRNILAAAVEGSQVDFETAQTVEARYFVELVTGQISKNMIQAF
FFDLQAVNSGANRPKDIEPRKVEKVAVLGAGMMGAGIAYACAKAGIQVVLKDVTPEAAQK
GKAYAEGLLAKALSRGRTTEQKRDELLARITPTAEPNDLAGCDAVIEAVFEDVALKRKVF
KEIQHIVAPDALLCSNTSTLPITLLAEGVERDQDFIGLHFFSPVDKMPLVEIIKGGRTGD
EALARAFDLVRQIKKTPIVVNDSRGFFTSRVIGHFINEGVAMVGEGLDPASVEQAAAQAG
YPAKVLSLMDELTLTLPRKIREETRRAAEEAGGTWQPHPADEVIDRMVDEFGRPGRSGGA
GFYEYGEDGKRAGLWPGLREHFAKEGAGIPFRDMQERMLFSEALDTVRCFEEGVLTSVAD
ANIGSIFGIGFPGWTGGVLQYINGYQGGPEREDLVGLPGFVARARELQAAYGDRFAPPAL
LIDKAEKGEKFSD
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaatccgccgctttgaccatccgctgggaacaggacgagaccggcatcgtcacc
ctggtcctggacgaccccggccagtccgccaacaccatgaacaatgccttcaagacctct
ctcaccgcggtcgccgaccgcctggaggccgagaaggacagcatccgcggcatcatcttc
acctccgcgaagaagaccttcttcgccggcggcgacctgcgcgacctgatcgccgtcacc
cccgcccaggcccagcgggccttcgagtcgggcaacggcatcaagcgcgacctgcgccgc
atcgaaacgctcggcaagcccgtcgtcgccgccatcaacggcgcggcgctgggcggcggt
tacgagatcgcgctcgcctgccaccaccgcgtcgccctcgacacccccggcaccaagatc
ggcctgcccgaggtcaccctcggcctgctgcccgccgccggcggtgtcacccgcacggtc
cggctgctcggcatcgccgacgcgctgctgaaggtgctgctccagggcacccagtacagc
gccccgcgcgccaaggaagccgggctgatccacgacgtcgcggccacccccgaggaactg
ctcgccaaggcccgcgccttcgtcgacgagcaccccgagtcccagcagccctgggacgtg
aaggggtaccgcatccccggcggcacgcccgcccagccgaagttcgcggccaacctcccg
gcgttccccgccaacctcaagaagcagctgaacggcgcgccgtacccggcgccgcgcaac
atcctcgccgcggccgtcgagggctcccaggtcgacttcgagaccgcgcagaccgtcgag
gcgcggtacttcgtcgagctggtgaccggccagatctccaagaacatgatccaggcgttc
ttcttcgacctccaggccgtcaactccggcgccaaccgccccaaggacatcgagccccgc
aaggtcgagaaggtcgcggtcctcggcgccggcatgatgggcgcgggcatcgcctacgcc
tgcgccaaggccggcatccaggtcgtcctcaaggacgtcaccccggaagcggcccagaag
ggcaaggcgtacgcggaggggctgctcgccaaggcgctctcccggggccgtacgaccgag
cagaagcgcgacgagctgctggcgcgcatcacgcccaccgccgagcccaacgacctcgcg
ggctgcgacgccgtcatcgaggcggtcttcgaggacgtcgccctcaagcgcaaggtgttc
aaggagatccagcacatcgtcgcgcccgacgcgctgctgtgctcgaacacctcgaccctc
cccatcacgctgctggccgagggcgtggagcgcgaccaggacttcatcgggctgcacttc
ttctcgccggtcgacaagatgccgctggtggagatcatcaagggcgggcggaccggcgac
gaggcgctggcccgcgccttcgacctggtccgccagatcaagaagaccccgatcgtcgtc
aatgactcccgcggcttcttcacctcccgggtcatcggccacttcatcaacgaaggcgtg
gcgatggtcggcgagggcctcgacccggcctccgtcgagcaggccgccgcccaggccggc
tacccggccaaggtgctgtcgctgatggacgagctgaccctgaccctgccccgcaagatc
cgcgaggagaccaggcgggcggccgaggaggccggcggcacctggcagccgcacccggcc
gacgaggtcatcgaccggatggtcgacgagttcgggcgccccggccgcagcggcggtgcc
ggcttctacgagtacggcgaggacggcaagcgcgccggcctgtggccgggcctgcgcgag
cacttcgccaaggagggggccggcatccccttcagggacatgcaggagcggatgctgttc
tccgaggcactggacaccgtccgctgcttcgaggagggcgtcctcacctctgtcgccgac
gccaacatcggctccattttcgggatcggcttcccgggctggaccggcggtgtgctccag
tacatcaacggctaccagggcgggccggagcgggaggacctggtcggtctgcccgggttc
gtggcccgcgcccgtgagctgcaggcggcctacggcgaccggttcgccccgcccgcgctg
ctgatcgacaaggccgaaaagggcgagaagttcagcgactga

DBGET integrated database retrieval system