KEGG   Streptomyces sp. PAMC 26508: F750_3277Help
Entry
F750_3277         CDS       T02619                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
strp  Streptomyces sp. PAMC 26508
Pathway
strp00250  Alanine, aspartate and glutamate metabolism
strp00410  beta-Alanine metabolism
strp00430  Taurine and hypotaurine metabolism
strp00650  Butanoate metabolism
strp01100  Metabolic pathways
strp01110  Biosynthesis of secondary metabolites
strp01120  Microbial metabolism in diverse environments
strp02024  Quorum sensing
Module
strp_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:strp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    F750_3277
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    F750_3277
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    F750_3277
   00430 Taurine and hypotaurine metabolism
    F750_3277
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    F750_3277
Enzymes [BR:strp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     F750_3277
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AGJ55746
UniProt: M9TTL1
LinkDB All DBs
Position
3446684..3448108
Genome map
AA seq 474 aa AA seqDB search
MALHQGRHGRPAPSEEHRRLALNPFFGEADPTAPMVAAPPTHRLPEDPLPPSTAYRLVHD
ELMLDGNSRLNLATFVTTWMEPQAGVLMSECRDKNMIDKDEYPRTAELERRCVAMLADLW
NAPDPASTVGCSTTGSSEACMLAGMALKRRWSAKNADRYPATARPNLVMGVNVQVCWEKF
CTFWEVEPRQVPMDGERFHLDPQAAAELCDENTIGVVGILGSTFDGSYEPIADLCAALDD
LQERTGLDIPVHVDGASGAMIAPFLDPDLVWDFRLPRVSSINTSGHKYGLVYPGVGWALW
RSPAELPEELVFRVNYLGGDMPTFALNFSRPGAQVVAQYYTFLRLGREGYRAVQQASRDI
ARRLAVQFEALEDFRLLTRGDELPVFAVTTKPDVQAYDVFDVSRRLRERGWLVPAYTFPA
NRQDLSVLRVVCRNGFSSDLAELLLDDLRGLLPELRSQPHPLHRDPGVQTAFHH
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggcgctccaccagggacggcacggccggcccgccccctcagaggaacaccgcagactc
gccctcaacccgttcttcggggaggccgacccgaccgcgcccatggtcgcggcgccaccg
acgcaccggctcccggaggatccgctgccgccgtcgaccgcctaccggctcgtccacgac
gagctgatgctcgacgggaactcccggctcaacctcgccaccttcgtcaccacctggatg
gaaccccaggcgggtgtgctgatgagcgagtgccgggacaagaacatgatcgacaaggac
gagtacccccgtaccgccgagctggagcggcgctgcgtggcgatgctcgccgacctctgg
aacgcgcccgatcccgcctccacggtgggctgttcgacgacggggtccagcgaggcctgc
atgctcgcggggatggcgctgaagcggcgctggtcggcgaagaacgccgaccgctatccg
gcgacggcacggcccaacctggtgatgggcgtcaacgtgcaggtctgctgggagaagttc
tgcacgttctgggaggtcgagccacgccaggtcccgatggacggtgagcgtttccacctg
gacccgcaggcggccgccgagctgtgcgacgagaacaccatcggtgtcgtcgggatcctc
ggttccaccttcgacggctcctacgagccgatcgccgacctctgcgccgcgctggacgac
ctccaggagcgcaccgggctcgacatcccggtccatgtggacggcgcgtccggggcgatg
atcgccccgttcctcgacccggacctggtctgggacttccggctgccccgggtgtcctcg
atcaacacctccggacacaagtacggcctggtctacccgggtgtgggctgggccctgtgg
cgttcaccggccgagctgccggaggagctggtcttcagggtcaactacctgggcggcgac
atgccgaccttcgcgctgaacttctcccggcccggcgcgcaggtggtcgcgcagtactac
acgttcctgcggctgggccgggagggctaccgggccgtgcagcaggcctcccgggacatc
gcgcgccggctcgccgtgcagttcgaggccctggaggacttcaggctcctgacccgcggc
gacgaactcccggtgttcgcggtgacgacgaagcccgacgtccaggcgtacgacgtcttc
gacgtgtccagacggctgcgggagcgcggctggctcgtgcccgcgtacaccttccccgcc
aaccgccaggacctctcggtgctgcgggtcgtctgccgcaacggcttctcctccgacctc
gcggagctgctgctggacgacctgcgggggctgctgcccgaactgcgctcccagccgcat
ccgttgcaccgggatcccggggtccagacggcgttccaccactga

DBGET integrated database retrieval system