KEGG   Streptomyces sp. SAT1: A8713_19060Help
Entry
A8713_19060       CDS       T04706                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
strt  Streptomyces sp. SAT1
Pathway
strt00564  Glycerophospholipid metabolism
strt01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:strt00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    A8713_19060
Enzymes [BR:strt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     A8713_19060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 FAD_binding_2 FAD_oxidored Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: ANH93005
UniProt: A0A1A9J2H6
LinkDB All DBs
Position
4388667..4390322
Genome map
AA seq 551 aa AA seqDB search
MAERELDILVVGGGVVGAGTALDAVTRGLSTGIVEARDWASGTSSRSSKLIHGGLRYLEM
LDFALVREALKERGLLLERLAPHLVKPVPFLYPLQHKGWERLYAGSGVALYDGMSMARGH
GRGLPVHRHLSRRHALRVAPCLKKDALVGALQYYDAQMDDARFVATLVRTAVSYGAPAAN
RARVTGFLREGERVVGARVQDVEGGGEYEVRAKQIVNATGVWTDDTQAMVGERGQFHVRA
SKGIHLVVPKDRINSTSGLILRTEKSVLFVIPWGRHWIIGTTDTDWDLDKAHPAASSADI
DYLLEHVNSVLAVPLGRDDVEGVYAGLRPLLAGESDATSKLSREHTVAHPVPGLVVVAGG
KYTTYRVMAKDAVDEAVHGLDMRVADCVTEETPLFGAEGYQALWNARARIAADTGIHVVR
VEHLLNRFGSAAREVLDLIAEDPSLGAPLKAADDYLRAEVVYAASHEGARHLDDVLTRRT
RISIETFDRGTRSAREAAELMAPVLGWDEDQIVREVEHYEKRVEAERESQRQPDDLTADA
ARLGAPDIAPL
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggccgagcgtgagctggacattctggtcgtgggtggcggcgtggtgggagcgggcacg
gccctggacgcggtcacgcgcggcctgtccaccggcatcgtcgaggcgcgcgactgggcg
tcgggcacctccagccggtccagcaagctcatacacggcggactgcgctatctggagatg
ctcgacttcgccctggtgcgcgaggcgctgaaggagcgcgggctgctgctggagcggctg
gccccgcacctggtcaagcccgtgccgttcctgtacccgctccagcacaagggctgggag
cggctgtacgcgggctcgggcgtcgccctctacgacggcatgtcgatggcccgcggacac
ggccggggactgcccgtgcaccgccacctgagccgccgtcacgccctgcgcgtggcgccc
tgcctgaagaaggacgccctggtcggcgccctccagtactacgacgcccagatggacgac
gcccgcttcgtggcgaccctggtgcgcaccgccgtgtcctacggcgcgccggcggccaac
cgggcgcgcgtgaccgggttcctgcgcgagggcgagcgggtggtcggcgcgcgggtgcag
gacgtcgagggcggcggcgagtacgaggtccgcgccaagcagatcgtcaacgccaccggg
gtgtggacggacgacacccaggcgatggtgggggagcgcggccagttccacgtccgcgcc
tccaagggcatccacctcgtcgtgcccaaggaccgcatcaactccaccagcgggctgatc
ctgcgcacggagaagtccgtcctgttcgtcatcccctgggggcggcactggatcatcggc
accacggacaccgactgggacctggacaaggcgcacccggccgcctccagcgccgacatc
gactatctgctggagcacgtcaactccgtgctcgccgtcccgctcggccgggacgacgtg
gagggcgtctacgcgggactgcggcccctgctggccggggagtccgacgccaccagcaag
ctgtcgcgcgagcacaccgtggcccatccggtgcccggcctcgtcgtggtcgcgggcggc
aagtacaccacctaccgggtgatggccaaggacgccgtcgacgaggcggtgcacggcctg
gacatgcgggtcgccgactgcgtcaccgaggagaccccgctgttcggcgccgagggctac
caggcgctgtggaacgcgcgggcgcgcatcgccgccgacaccggcatccacgtggtgcgc
gtcgagcacctgctgaaccggttcgggtcggccgcgcgggaggtcctcgacctgatcgcc
gaggacccctcgctcggcgcgccgctcaaggccgccgacgactatctgcgggccgaggtc
gtctacgccgcctcccacgagggcgcccgccatctggacgacgtgctcacccggcgcacc
cgcatatccatcgagaccttcgaccggggcacccgcagcgcccgcgaggccgccgagctg
atggcgccggtcctcggctgggacgaggaccagatcgtccgcgaggtcgagcactacgag
aagcgggtcgaggccgagcgcgagtcgcagcgccagcccgacgacctgaccgccgacgcg
gcccggctgggcgctccggacatcgcgccgctgtag

DBGET integrated database retrieval system