KEGG   Streptomyces qaidamensis: A4E84_03775Help
Entry
A4E84_03775       CDS       T04777                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
stsi  Streptomyces qaidamensis
Pathway
stsi00250  Alanine, aspartate and glutamate metabolism
stsi00410  beta-Alanine metabolism
stsi00640  Propanoate metabolism
stsi00650  Butanoate metabolism
stsi01100  Metabolic pathways
stsi01120  Microbial metabolism in diverse environments
Module
stsi_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:stsi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    A4E84_03775
   00650 Butanoate metabolism
    A4E84_03775
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    A4E84_03775
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    A4E84_03775
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:stsi01007]
    A4E84_03775
Enzymes [BR:stsi01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     A4E84_03775
Amino acid related enzymes [BR:stsi01007]
 Aminotransferase (transaminase)
  Class III
   A4E84_03775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AMW08706
UniProt: A0A143BU08
LinkDB All DBs
Position
complement(847498..848766)
Genome map
AA seq 422 aa AA seqDB search
MTALSPHLRQATPVVADRGEGVHLYGEDGRRYLDFTAGIGVTSTGHCHPKVVAAAQEQVG
TLIHGQYTTVMHQPLRRLVDKLGEVLPAGLDSLFFTNSGSEAVEAALRLARQATGRPNVI
VCHGGFHGRTVAAASMTTSGIRFRSGFSPLMSGVVVTPFPTAFRYGWDEETATRFALKEL
DYTLQTISSPADTAAIIVEPVLGEGGYVPANRAFMEGLRERADRHGFLLILDEVQTGVGR
TGRFWGHDHFGVTPDILVTAKGLASGFPLSGIAASEELMTKAWPGSQGGTYGANAVACAA
ACATLDVVRDEKLVENAEAMGKRLRQGLEAVADRTPGIGDVRGLGLMLATEFVTEDGSPD
SETAARVQRAAIDEGLLLLLCGASNQVVRMIPALVIDEAGVDEGLQAWTNAVEAGTSGAG
ER
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcactgtcgccgcaccttcgccaggccacgcccgtcgtggcggaccggggcgag
ggcgtccacctctacggtgaggacggccgccgctacctcgacttcaccgccggcatcggc
gtcaccagcaccgggcactgccaccccaaggtcgtggcggcggcacaggagcaggtgggc
acgctgatccacggccagtacacgaccgtcatgcaccagccgctgcgccgcctggtcgac
aagctgggcgaggtgctgccggccggcctggacagcctgttcttcaccaactccggcagc
gaggccgtcgaggcggcgctgcggctggcccgccaggccaccggccggccgaacgtcatc
gtctgccacggcggcttccacggccgtacggtcgccgccgcctccatgaccacctccggc
atccgcttccggtccgggttctcgccgctgatgagcggcgtggtcgtcaccccgttcccg
acggccttccggtacggctgggacgaggagaccgccacccgcttcgccctgaaggaactc
gactacaccctccagacgatctcgtcgcccgcagacacggcagcgatcatcgtcgagccg
gtcctcggcgagggcggctacgtgcccgcgaaccgcgccttcatggagggcctgcgggaa
cgggcggaccggcacggcttcctgctgatcctcgacgaggtgcagaccggagtcggccgc
accggccgcttctggggccacgaccacttcggcgtcacccccgacatcctcgtcaccgcc
aagggcctggccagcggttttcccctctccggcatcgccgcctccgaggaactgatgacc
aaggcctggcccggctcgcagggcggcacgtacggcgccaacgccgtggcctgcgccgcc
gcctgcgcgacgctcgacgtcgtacgcgacgagaagctcgtcgagaacgccgaggccatg
ggcaagcggctccgccagggcctggaggccgtggccgaccggaccccgggcatcggcgac
gtccgcggcctcggcctcatgctcgccaccgagttcgtcaccgaggacggcagccccgac
tccgagaccgcggcccgcgtgcagcgcgccgcgatcgacgagggcctgctcctgctgctg
tgcggcgcctcgaaccaggtcgtccgcatgatcccggcactcgtgatcgacgaggcgggc
gtcgacgagggccttcaggcctggacgaacgcggtcgaggccggcacgtcgggagccgga
gagcgatga

DBGET integrated database retrieval system