KEGG   Streptomyces qaidamensis: A4E84_22630Help
Entry
A4E84_22630       CDS       T04777                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
stsi  Streptomyces qaidamensis
Pathway
stsi00250  Alanine, aspartate and glutamate metabolism
stsi00410  beta-Alanine metabolism
stsi00430  Taurine and hypotaurine metabolism
stsi00650  Butanoate metabolism
stsi01100  Metabolic pathways
stsi01110  Biosynthesis of secondary metabolites
stsi01120  Microbial metabolism in diverse environments
stsi02024  Quorum sensing
Module
stsi_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:stsi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    A4E84_22630
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    A4E84_22630
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    A4E84_22630
   00430 Taurine and hypotaurine metabolism
    A4E84_22630
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    A4E84_22630
Enzymes [BR:stsi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     A4E84_22630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AMW12044
UniProt: A0A143C3Q4
LinkDB All DBs
Position
complement(5092802..5094208)
Genome map
AA seq 468 aa AA seqDB search
MPLHEGPHRAAGRRMSVNPFYGPANPLGDMAEAPPTHRLPDQPMAPSTAHQLVRDELMLD
GNARLNLATFVTTWMEPEAGVLMAECRDKNMIDKDEYPRTAELERRCVAMLADLWNAPDP
ATAVGCSTTGSSEACMLAGMALKRRWAKRNADRYPGARPNLVMGVNVQVCWEKFCNFWEV
EARLVPMEGERFHLDPQAAAELCDENTIGVVGILGSTFDGSYEPVADLCAALDALRERTG
LDIPVHVDGASGAMVAPFLDEDLVWDFRLPRVASINTSGHKYGLVYPGVGWALWRDAEAL
PEELVFRVNYLGGDMPTFALNFSRPGAQVVAQYYTFLRLGRDGYRAVQQAARDVATGLAG
RVEALGDFRLLTRGDELPVFAFTTAPDVTAYDVFDVSRRLRENGWLVPAYTFPPNREDLS
VLRVVCRNGFSADLAELLAQDLERLLPDLRRQPRPLTEDKGAATSFHH
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgccgctccacgaaggtccccaccgggccgccggacgccgcatgtccgtcaaccccttc
tacggccccgccaacccgctcggcgacatggccgaggccccgcccacccaccggctcccg
gaccagcccatggcgccgtcgaccgcccaccagctggtgcgcgacgagctgatgctcgac
ggcaacgcccggctgaacctcgccaccttcgtcaccacgtggatggagccggaggccggg
gtgctgatggcggagtgccgggacaagaacatgatcgacaaggacgagtacccgcgcacc
gccgagctggagcggcgctgcgtggcgatgctcgccgacctgtggaacgcgcccgacccg
gcgaccgccgtggggtgttcgacgaccgggtcgagcgaggcgtgcatgctcgccgggatg
gcgctgaagcggcgctgggcgaagcgcaacgccgaccgctaccccggggcgcggcccaac
ctggtcatgggcgtcaacgtgcaggtctgctgggagaagttctgcaatttctgggaggtg
gaggcccggctggtgcccatggagggcgagcggttccacctcgacccgcaggccgcggcc
gagctgtgcgacgagaacaccatcggcgtcgtcggcatcctcggctcgaccttcgacggg
tcctacgagccggtcgccgacctgtgcgcggcgctggacgcgttgcgggagcggaccggg
ctcgacatccccgtgcacgtcgacggggcgtcaggtgccatggtcgcgcccttcctcgac
gaggacctggtgtgggacttccggctgccgagggtggcgtcgatcaacacctcggggcac
aagtacgggctggtctacccgggcgtcggctgggcgctgtggcgggacgcggaagcgctg
ccggaggagctggtgttccgggtgaactacctgggcggcgacatgccgacgttcgcgctg
aacttctcccggccgggcgcgcaggtcgtggcgcagtactacacgttcctgcggctgggc
cgggacggctaccgggccgtccagcaggccgcgcgggatgtggccacggggctggccggg
cgggtcgaggcgctcggcgacttccggctgctgacccggggcgacgaactgccggtgttc
gccttcacgaccgcgcccgacgtgacggcgtacgacgtcttcgacgtgtcccggcggctg
cgcgagaacggctggctggtgcccgcgtacaccttcccgccgaaccgggaggacttgtcc
gtgctgcgggtggtgtgccgcaacggcttctccgccgacctcgcggagctgctcgcgcag
gacctggaacggctgctgccggacctgcgccggcagccgcgcccactgacggaggacaag
ggcgcggcgacgagcttccaccactaa

DBGET integrated database retrieval system