Streptomyces tsukubensis: B7R87_21965 Help Entry B7R87_21965       CDS       T07155                                  Name (GenBank) hypothetical protein   KO K05553   minimal PKS acyl carrier protein Organism stsu  Streptomyces tsukubensis Pathway stsu00253   Tetracycline biosynthesis stsu01056   Biosynthesis of type II polyketide backbone stsu01100   Metabolic pathways stsu01110   Biosynthesis of secondary metabolites Module stsu_M00778   Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide Brite KEGG Orthology (KO) [BR:stsu00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     B7R87_21965    00253 Tetracycline biosynthesis     B7R87_21965  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:stsu01004]     B7R87_21965    01008 Polyketide biosynthesis proteins [BR:stsu01008]     B7R87_21965 Lipid biosynthesis proteins [BR:stsu01004]  Polyketide synthase   Component type    B7R87_21965 Polyketide biosynthesis proteins [BR:stsu01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      B7R87_21965     Nonaketide PKS      B7R87_21965     Decaketide PKS      B7R87_21965 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AZK96234 UniProt:  A0A5H2URD8 LinkDB All DBs Position 5232064..5232321 Genome browser AA seq 85 aa AA seqDB search MSELTLPDLVEIFRQCAGEAEGADLQSDDVGDRELAALGYDSLALLEAISHVERKYAIGM PDAETRIRTLNEFLDEANEQLTRQP NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgagtgaactcaccctgccggacctggtcgagatcttccggcagtgcgccggcgaggcg gagggagccgatctgcagagcgacgacgtcggggacagggagctggcggccctcggctac gattcgctcgccctgctggaggcgatcagccatgtcgagcggaagtacgcgatcggcatg ccggacgcggagacccggatccggacgctgaacgaattcctcgacgaggccaacgaacaa ctgacccggcagccctga

DBGET integrated database retrieval system