KEGG   Salmonella enterica subsp. enterica serovar Typhi CT18: STY4576
Entry
STY4576           CDS       T00064                                 

Definition
(RefSeq) hypothetical protein
Organism
sty  Salmonella enterica subsp. enterica serovar Typhi CT18
SSDB
Motif
Pfam: TraU
Other DBs
NCBI-GeneID: 1250780
NCBI-ProteinID: NP_458661
GeneDB: STY4576
UniProt: Q8Z1I9
LinkDB
Position
4453846..4454814
AA seq 322 aa
MKSLRLKRALLSVMLITGGMEVQAALNTASIVASSISPSCISWRISGICYWLMCTPFGCT
VKTSIKVHHFIPEAVVSTYQASGGNPWTEMSLVSQTAGGVENAVTGALSGLAAGGGNQEQ
KFPGTRKSNVRFKYADAIGHPSTSIIGGQIPGYSCNSAATPLVPYFLSTLDTLAWRTGVP
ESVYPEALIPGRREIGSTSAQNIWGNLYPRSGFVTQQDDYKSGAIVAQRVADIITRTNQI
HVYKPLTGNPSAGYWPPEPVKENTGTQNHKWQQLSPTLSMSCSVFPDTGKIAENGNYAWT
LWQPYSCCKRRGQTFLYSTDIN
NT seq 969 nt   +upstreamnt  +downstreamnt
atgaaatctcttcgtctgaagcgagcgttactgtcagtcatgcttatcaccggcggcatg
gaggttcaggctgcgttgaacactgcctcgattgtggccagcagtatttctccgtcgtgt
atcagctggagaatcagcggtatctgctactggctgatgtgtacccctttcggttgtaca
gtaaaaacctcgataaaagtgcatcactttattccggaagctgttgtttcgacttatcag
gcgtctggtggaaatccgtggaccgaaatgtcattagtgagtcagacggccggaggggta
gagaatgctgtaacgggggcgttatccgggcttgctgccggtggcggaaaccaggaacag
aaattcccgggtacccgtaagagtaatgtgcgatttaaatatgcagatgccattggccat
ccttcaacatcgattattggcggccaaatccccggttactcatgcaacagcgccgccaca
ccactggtaccctattttcttagcacgcttgatacgcttgcctggcgtactggtgttcct
gaatcggtttatcctgaggcactcattcctggcagacgcgaaatcggctccacatcggca
caaaatatatggggaaatctctatccccgaagcggctttgttactcagcaggatgactac
aaatccggggcaatcgttgcgcagcgtgtagctgacattatcacccgaactaaccagatc
cacgtctataagcccctcaccggaaacccgtctgccggttactggcctcccgaacctgtt
aaagagaataccggcacgcaaaatcataaatggcagcagttatcaccaacgctctctatg
tcatgcagcgtattcccggatacaggaaaaattgcggaaaacggtaattacgcctggaca
ctctggcagccatatagctgctgtaaacgccgtgggcaaacatttctctatagcaccgac
ataaattaa

DBGET integrated database retrieval system