KEGG   Sulfitobacter sp. AM1-D1: BOO69_18745Help
Entry
BOO69_18745       CDS       T04555                                 

Definition
(GenBank) DNA ligase D
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
suam  Sulfitobacter sp. AM1-D1
Pathway
suam03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:suam00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    BOO69_18745
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:suam03400]
    BOO69_18745
Enzymes [BR:suam01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BOO69_18745
DNA repair and recombination proteins [BR:suam03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     BOO69_18745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_C DNA_ligase_A_M RNA_ligase DNA_primase_S DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: APE45609
UniProt: A0A1J0WMK0
LinkDB All DBs
Position
unnamed1:27840..30260
Genome map
AA seq 806 aa AA seqDB search
MGRLDRYIEKRDFDRTPEPRDGAAGDALALRYSMQKHDATRTHFDLRLEWDGALLSWAVT
RGPSLHPSDKRLSVRTEDHPLSYLGFEGTIPEGNYGAGTVMLFDIGHWQPVEPVEKGLKK
GHLHFRLHGQRLTGGWHLVRMKGRKSGDKGRENWLLIKEEDEASGRRDPVDRYRRSTSTN
RTLREIAAEKPVVPGGHAGKRPKFRKIQLASLVDEAPSGKDWWHEVKLDGYRALVALGKG
GPRIFTRNGHDWTDRFESLLPAFDAMDCDSALIDGEIVAGAGLQGFSSLQKAIKAGGPFR
FYGFDLLEADGRKWIDQPLADRRERLEKIFHDAPPLGLAQLSPIIDGAPDDALAKICKAG
GEGIISKRTDQPYRGTRTSNWRKVKCERRDEFVILGWQESEKRGRPFASLALGAYEGGGL
TYVGKVGTGFDADTMEDLQSAMSGMERKTAPADIPKDESRGVTWITPKLVAEIKYAEKTD
DGRLRHAVFIALREDKPARTVKVEEDRMDNDRVEIAGIGVSHPNRKVYPAAGITKRQVAE
YYEAMADRILEDAADRPLSLVRLPEGIEGERFFQKHAGKGFPDEIRTVQIEESDGDTADY
MYVSTAAGLVGAAQMGAMEFHVWGSRRDDLDRPDRMVFDLDPDESLGFSDVTAAALDLRD
ILSDLDLPCWPLVTGGKGVHVVVPLRRIANWDTVKLYSKVLAKHLADTQPDRFTASMSKS
RRSGRIFIDWLRNERGSTAIAPFSLRARPGAPVATPVGWDELSAVTSADAFPMAKALERN
WSDASVPKPAGLSNGRIDLLDKLVGQ
NT seq 2421 nt NT seq  +upstreamnt  +downstreamnt
atgggacggctggaccgttatatcgagaaacgggacttcgaccggacgcccgaaccccgc
gatggcgctgcgggcgatgcgctcgcgctccgctattccatgcagaaacacgatgcgacc
agaacccatttcgatctgcggcttgaatgggacggcgcattgttgagctgggcggtcaca
cgcgggccctcgctgcatccgtcggataagcggctgtcggtccggacggaggaccacccg
ctgtcctacctgggcttcgaagggacgattcccgaaggcaattacggtgccggtacggtc
atgctgttcgacatcgggcactggcaaccggtggagcctgtcgagaagggtctgaagaag
gggcatctgcatttccggctgcacggccagcggctgaccggcggttggcatcttgtccga
atgaagggccgcaaatccggcgacaagggccgggagaactggctgctcattaaggaggag
gacgaggcgtcagggcgtcgtgaccccgtagaccgctaccgccgcagcacttcgacgaac
cggaccctgcgcgagatcgcggcggagaaacccgtcgtgccgggcggccatgcgggaaag
cgccccaagttccgcaagatacagctagcctcgctggtggatgaagccccctcggggaag
gactggtggcatgaagtcaagcttgacggctaccgcgcgctggtcgccctcggcaagggc
gggccgcggatctttacccgcaatgggcacgactggaccgacaggttcgaaagcctgctg
cccgcattcgatgcgatggactgcgactccgcgctgatcgacggcgagatcgtcgcgggc
gcggggcttcagggtttttccagcctccagaaggcgatcaaggcaggtggcccgttcagg
ttctacggcttcgacctgctcgaagcggacgggcgcaaatggatcgaccagccgctcgcc
gaccggcgcgagaggctggaaaagatctttcacgacgcaccgcccctcgggctggcacaa
ttgtcgccgatcatcgacggcgcgccggacgatgcgcttgccaaaatctgcaaggcaggc
ggcgagggcattatttccaagcggaccgaccagccctaccgcggcacgcggaccagcaac
tggcgcaaggtcaaatgcgaacggagagacgaattcgtcatcctgggctggcaggaaagc
gaaaagcggggccggcccttcgcctctctcgcgctcggcgcctacgagggcggcggcctg
acctacgtgggcaaggtcggcaccgggttcgatgccgacaccatggaagatttgcaatcc
gccatgtcgggaatggaacgcaagaccgctccggcggacatccccaaggatgaaagccgg
ggggtgacctggatcacgccgaaactggtcgccgagatcaagtacgccgagaagacggac
gacggacggcttcggcatgccgtgttcatcgcattgcgcgaggacaagcccgcccgcacc
gtcaaggtggaggaggaccgcatggacaacgatcgcgtcgaaattgccggaatcggcgtc
agccacccgaaccggaaagtctaccccgcagcgggcatcaccaagcgccaggttgcagaa
tactacgaggcgatggccgaccgtattctggaggacgcggccgaccggcctctctcgctg
gtgcggctgcctgaagggatcgaaggggaacggttctttcagaaacacgcgggaaagggc
tttcccgacgagatacgcacggtgcagatcgaggaaagcgacggcgacacggcggactac
atgtacgtgtcgaccgccgcggggctggtcggcgcggcgcagatgggagcgatggaattt
cacgtctgggggtcaaggcgggatgacctcgaccgtcccgacaggatggtattcgacctc
gatccggatgaaagcctcggattttcggatgtgacggctgccgctctggacctccgggac
atcttgtcggatctcgacctgccctgctggcccctcgtcaccggtggcaagggggtgcac
gtggtggtcccgctgcgccggattgccaactgggatacggtgaagctttattccaaggtc
ctggcaaaacacctcgccgacacccagccggaccggttcaccgcctcgatgtcgaaatca
cgccgctccgggcggatcttcatcgactggctgcgcaacgaacgggggtcgaccgcgatc
gcgccgttctcattgcgggcgcggcccggtgcgccggtcgcgacgccggtcggctgggac
gaactgtcagccgtgacgtcggccgatgccttcccgatggcgaaggcccttgaacggaac
tggtcggatgcgagcgtgccgaagccggcgggtctctcgaatggccggatagacctgctg
gacaagcttgtcggccagtga

DBGET integrated database retrieval system