KEGG   Staphylococcus aureus subsp. aureus ED133: SAOV_1237Help
Entry
SAOV_1237         CDS       T01869                                 

Definition
(GenBank) chromosome segregation SMC protein
  KO
K03529  chromosome segregation protein
Organism
sue  Staphylococcus aureus subsp. aureus ED133
Brite
KEGG Orthology (KO) [BR:sue00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sue03036]
    SAOV_1237
Chromosome and associated proteins [BR:sue03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Condensin-like complex
    SAOV_1237
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SMC_N SMC_hinge AAA_23 AAA_15 AAA_21 AAA_29 FliJ Mod_r SbcCD_C AAA_13
Motif
Other DBs
NCBI-ProteinID: ADI97749
LinkDB All DBs
Position
1260837..1264403
Genome map
AA seq 1188 aa AA seqDB search
MVYLKSIDAIGFKSFADQTNVQFDKGVTAIVGPNGSGKSNITDAIKWVLGEQSAKSLRGS
KMEDIIFSGAEHRKAQNYAEVQLRLDNHSKKLSVDENEVIVTRRLYRSGESEYYINNDRA
RLKDIADLFLDSGLGKEAYSIISQGRVDEILNAKPIDRRQIIEESAGVLKYKKRKAESLN
KLDQTEDNLTRVEDILYDLEGRVEPLKEEAAIAKEYKTLSHQMKHSDIVVTVHDIDQYTN
DNRQLDQRLNDLQGQQANKEADKQRLSQQIQQYKGKRHQLDNDVESLNYQLVKATEAFEK
YTGQLNVLEERKKNQSETNARYEEEQENLIELLENISNEISEAQDTYKSLKSKQKELNAV
IRELEEQLYVSDEAHDEKLEEIKNEYYTLMSEQSDVNNDIRFLKHTIEENEAKKSRLDSR
LVEVFEQLKDIQGQIKTTKKEYQQTNKELSAVDKEIKNIEKDLTDTKKAQNEYEEKLYQA
YRYTEKMKTRIDSLTTQEEEYTYFFNGVKHILKAKNKELKGIHGAVAEIIDVPSKLTQAI
ETALGASLQHVIVDSEKDGRQAIQFLKERNLGRATFLPLNVIQSRVVATDIKSIAKEANG
FISIASEAVKVSPEYQNIIGNLLGNTIIVDHLKHANELARAIKYRTRIVTLEGDIVNPGG
SMTGGGARKSKSILSQKDELTTMRHQLEDYLRQTESFEQQFKELKIKSDQLSELYFEKSQ
KHNTLKEQVHHFEMELDRLTTQETQIKNDHEEFEFEKNDGYTSDKSRQTLSEKETHLESI
KASLKRLEDEIERYTKLSKEGKESVTKTQQTLHQKQSDLAVVKERIKTQQQTIDRLNNQS
QQTKHQLNDVKEKIAFFNSDEVMGEQAFQNIKDQINGQQETRTRLSDELDKLKQQRIELN
EQIDAQEATLQVCHQDILAIENHYQDIKAEQSKLDVLIHHAIDHLNDEYQLTVERAKSEY
TSDESIDALRKKVKLMKMSIDELGPVNLNAIEQFEELNERYTFLSEQRTDLRKAKETLEQ
IISEMDQEVTERFKETFHAIQGHFTAVFKQLFGGGDAELQLTEADYLTAGIDIVVQPPGK
KLQHLSLLSGGERALTAIALLFAILKVRSAPFVILDEVEAALDEANVIRYAKYLNELSDE
TQFIVITHRKGTMEFADRLYGVTMQESGVTKLVSVNLNTIDDVLKEEQ
NT seq 3567 nt NT seq  +upstreamnt  +downstreamnt
atggtttatttaaaatcaatagatgccattggatttaagtcttttgcagatcaaaccaat
gttcaattcgataaaggtgtaactgcaattgttggtccaaatggaagcggtaaaagtaat
attacagatgctattaaatgggtgttgggtgaacaatcggctaaatcattacgtggctca
aaaatggaagatattatcttctcaggtgcagaacatcgcaaagctcaaaattatgctgaa
gtacagttaagattagataatcattctaaaaagctcagtgttgatgaaaacgaagttatt
gtaacaagaagattgtatcgaagtggtgaaagtgagtactacataaataatgaccgtgca
agattaaaagatattgccgatttatttttagattctggattggggaaagaagcatatagc
attatctcgcaaggtagagttgatgaaatactaaatgctaaaccaattgatagacgtcaa
attattgaagaatcggctggtgtacttaaatataaaaaacgtaaagctgaatcattaaat
aaacttgaccaaacagaagataatttaacgagagtagaagacattttatatgatttggaa
ggtcgcgtagaacctctaaaagaggaggcagctatagctaaagaatataagacactttcg
caccaaatgaaacatagtgacattgtagttacagtgcacgatattgatcaatatacaaat
gacaatagacaattagatcaacgtttaaatgatttacaaggtcaacaagcaaataaagaa
gctgacaagcaacgtttaagccaacaaattcaacaatataaaggtaaacgtcatcaactt
gataatgatgttgaatcgcttaattatcaattagtaaaagctacggaagcctttgaaaaa
tatacgggacaattaaatgttttagaagaacgtaagaaaaatcaatctgaaacaaatgca
cgatatgaagaagaacaagaaaatttaattgagcttttagaaaatatatcaaatgagatt
tctgaagctcaagatacttataagtctctgaaaagtaaacaaaaagaactcaacgctgtc
attcgtgaattagaagaacaactatatgtttcagacgaagcgcacgatgaaaaattggaa
gaaattaaaaacgaatactatacattaatgtcagagcaatcagatgttaacaatgatatt
cgttttttaaagcatactatagaagagaatgaggctaaaaaatcaagactagattctcga
ttagttgaagtctttgagcaattgaaagatattcagggtcaaataaaaacgactaaaaaa
gaatatcaacagaccaacaaagaactttctgctgtagataaagaaattaaaaatatagaa
aaagacctcactgatacaaaaaaagcacaaaacgaatacgaagagaaattgtatcaagca
tatcgatataccgaaaaaatgaaaacacgtattgatagtttgacaacgcaagaggaagaa
tatacttattttttcaatggcgtcaaacatattttgaaagctaaaaataaagaattaaag
ggtattcatggtgcagttgcggaaattattgatgtgccatctaaattaactcaggcaatt
gaaacagcattaggtgcttcattacaacatgttattgtagattcagaaaaagatggacgc
caggctattcaatttttaaaagaacgtaatttaggtcgtgcgacgtttttaccattaaat
gttatacagagtagagtggtagcgactgatattaagtctattgctaaagaggcaaacgga
tttattagtattgcttcggaagcagttaaagtatcaccagaatatcaaaatattatcggg
aatttattaggtaatacgattatcgttgatcatttaaagcatgcaaatgaattggcacgt
gcgattaaatatcgaactcgtattgttactttggaaggtgatattgtaaatcctggtggt
tctatgactggtggtggcgctcgtaagtcaaaaagtattctgtctcaaaaagacgagttg
acaacaatgagacaccaattagaagattacttgcgtcaaacagaatcatttgaacaacaa
tttaaagagttgaagataaaaagtgatcaattaagtgaactgtattttgaaaaaagtcaa
aagcataatacacttaaagagcaagtgcatcattttgaaatggagctcgatagattaact
acacaagaaacacaaataaaaaatgatcatgaagaattcgaatttgaaaaaaatgatggt
tatacgagtgacaaaagtcgacaaactttgagtgaaaaagaaactcatttagaaagtatt
aaagcatctttaaaacgactagaagatgaaattgaacgctacacaaaactttctaaagaa
ggtaaggaaagcgtaactaaaacacaacaaacgttacatcagaaacaatctgatcttgct
gtggttaaagagcgtattaaaacacaacaacagacaatagatcgattaaataatcaaagt
caacaaaccaaacatcaattaaatgatgttaaagaaaaaattgcattctttaattcggat
gaagtgatgggcgaacaagcttttcaaaatattaaagatcaaattaatggtcaacaagaa
acgagaacacgcttatctgatgaattagataaattgaaacaacaacgtattgagttgaat
gaacaaatcgatgcgcaagaagctacactacaagtttgtcaccaagatattttagctatc
gaaaatcactaccaagatattaaagctgaacaatcaaaactagatgtattaattcatcat
gcgatagatcatttaaatgatgaatatcaattgactgttgaacgtgcaaaatctgaatat
acgagtgatgaatcgattgacgcattacgtaaaaaagttaaattaatgaagatgtcgatt
gatgaactaggtcctgtaaacttaaatgcaattgaacaatttgaagagttaaatgagcgt
tatacatttttaagtgagcaacgtacagatcttcgtaaagctaaagaaacattagagcaa
attataagtgaaatggatcaagaggttactgaaagatttaaagaaactttccatgctatt
caaggacattttacagctgtgttcaaacaattgtttggtggaggcgatgcagaattgcaa
ttaactgaagccgattatttaacagctggtattgatattgtggtacaaccaccgggtaaa
aagttgcaacatttatcgttactaagtggtggtgagcgtgcattaactgctattgcttta
ctatttgcaattttaaaagtaagatctgcaccttttgttatattagatgaggttgaagct
gcattagatgaagcgaatgttattagatacgcaaaatatttaaatgagttatcagacgaa
acacaattcattgttattacacaccgtaaaggaacaatggaatttgcagataggttatac
ggtgtaacaatgcaagaatcaggtgttactaaacttgtgagtgtgaatttaaatacaata
gatgatgtgttgaaggaggagcaataa

DBGET integrated database retrieval system