KEGG   Streptococcus suis JS14 (serotype 14): SSUJS14_1746Help
Entry
SSUJS14_1746      CDS       T02024                                 

Definition
(GenBank) hypothetical protein
  KO
K01875  seryl-tRNA synthetase [EC:6.1.1.11]
Organism
sui  Streptococcus suis JS14 (serotype 14)
Pathway
sui00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:sui00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SSUJS14_1746
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sui01007]
    SSUJS14_1746
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sui03016]
    SSUJS14_1746
Enzymes [BR:sui01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.11  serine---tRNA ligase
     SSUJS14_1746
Amino acid related enzymes [BR:sui01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   SSUJS14_1746
Transfer RNA biogenesis [BR:sui03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    SSUJS14_1746
 Prokaryotic type
    SSUJS14_1746
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2b Seryl_tRNA_N DUF3450 Spc7 JIP_LZII FapA DUF677 Cauli_AT GAS TMPIT
Motif
Other DBs
NCBI-ProteinID: ADV70804
LinkDB All DBs
Position
1723044..1724318
Genome map
AA seq 424 aa AA seqDB search
MLDIKRIRTDFDGVAAKLATRGVAAETLANIKELDAKRREILVTVEELKAERNTVSAEIA
QAKRNKENADDKIAAMQKLSADVKNLDAQLLEIDEELNAIITVLPNTPHDSVPVGADEEE
NVEVRRWGTPREFTFEPKAHWDLGEDLDILDWERGAKVTGARFLFYKNLGARLERALYNF
MLDEHIAEGYQEIITPYMVNHDSMFGTGQYPKFKEDTFELADTNFVLIPTAEVPLTNYYR
NEILEEKDLPIYFTAMSPSFRSEAGSAGRDTRGLIRLHQFHKVEMVKFATPEQSYDELEK
MTANAENILQKLGLPYRVLALCTGDMGFSAAKTYDLEVWIPAQNAYREISSCSNTEDFQA
RRAQIRYRDAADGKVKLLHTLNGSGLAVGRTVAAILENYQNEDGSVTIPEVLRPYMGGVE
VIKP
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgctagatatcaaacgtattcgtactgattttgacggagtggctgccaaattagctact
cgtggtgtggctgctgaaaccttggcaaacatcaaggaattggatgcaaaacgccgtgaa
atcttggttactgtagaagaattaaaagcagagcgcaacaccgtttctgcggagattgcc
caagcaaaacgcaataaggaaaacgctgacgacaagattgctgccatgcagaaactgtct
gcggatgtgaaaaacttagacgctcagcttttggaaatcgatgaagaattaaacgccatc
atcaccgttcttccaaatacgccgcacgattctgttccagttggtgcggatgaagaagaa
aacgtagaggttcgccgttggggaacacctcgtgaattcactttcgagccaaaagctcac
tgggatttgggcgaagacctagatattctggactgggaacgtggcgcaaaagtaactggt
gcacgcttcctcttctacaagaacttgggtgctcgcttagaacgtgccctctacaacttc
atgttggacgagcatatcgcagaaggctaccaagaaatcatcacgccttacatggtcaac
cacgactctatgtttggtactggtcaatatcctaagttcaaggaagatacttttgagttg
gcagacactaacttcgtcctcatcccaactgcggaagtgccgttgaccaactactaccgc
aacgagattctggaagaaaaagacctgccaatctacttcacagccatgagcccatctttc
cgttctgaagctggttctgccggtcgtgacacccgtggtcttatccgccttcaccaattc
cacaaggttgaaatggtcaaatttgccacaccagaacagtcttatgatgaattggaaaaa
atgacagcaaacgcagagaatattctccaaaaactaggcttgccttaccgcgttttggcc
ctctgtacaggcgatatgggcttctcagctgctaagacctatgacttggaagtctggatt
cctgcccaaaatgcctaccgtgaaatttcaagctgttccaacacagaagatttccaagct
cgtcgcgcccaaatccgctaccgcgatgctgctgacggtaaagtcaaattgctccacacc
ctcaacggttctggtctagcggttggtcgtacagtggctgccatccttgaaaactatcaa
aatgaagacggttctgtcaccattccagaagttctccgtccatacatgggtggggtagaa
gtgattaaaccttaa

DBGET integrated database retrieval system