KEGG   Staphylococcus aureus subsp. aureus JKD6159 (CA-MRSA): SAA6159_00355Help
Entry
SAA6159_00355     CDS       T01870                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase, large subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
suj  Staphylococcus aureus subsp. aureus JKD6159 (CA-MRSA)
Brite
KEGG Orthology (KO) [BR:suj00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SAA6159_00355 (ahpF)
Enzymes [BR:suj01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     SAA6159_00355 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA HI0933_like FAD_binding_2 Thi4 DAO FAD_oxidored AlaDh_PNT_C FAD_binding_3 K_oxygenase NAD_binding_9 NAD_binding_8 Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: ADL22311
LinkDB All DBs
Position
complement(403981..405504)
Genome map
AA seq 507 aa AA seqDB search
MLNADLKQQLKQLLELMEGNVEFVASLGSDDKSKELKELLTEISDMSPRLSLSEKSLKRT
PSFSVNRPGEETGVTFAGIPLGHEFNSLVLAILQVSGRAPKEKQSIIDQIKNLEGSFHFE
TFISLTCQKCPDVVQALNLMSVINPNITHSMIDGAVFREESENIMAVPAVFLNGEEFGNG
RMTIQDILSKLGSTADASEFENKEPYDVLIVGGGPASGSAAIYTARKGLRTGIVADRIGG
QVNDTAGIENFITVKETTGSEFSSNLAAHIDQYDIDAMTGIRATDIEKTDEAIKVTLENG
AVLESKTVIIATGAGWRKLNIPGEEQLINKGVAFCPHCDGPLFENKDVAVIGGGNSGVEA
AIDLAGIVNHVTLFEFASELKADNVLQDRLRSLPNVDIKTNAKTTEVVGEDHVTGIRYED
MSTGEEHLLNLDGIFVQIGLLPNTSWLKDAVELNERGEIVIDRNNNTNVPGIFAAGDVTD
QKNKQIIISMGAGANAALNAFDYIIRN
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgcttaatgctgatttaaaacaacaacttaaacaactattagaactaatggagggcaac
gttgaattcgttgccagccttggttcagatgataaatctaaggaactcaaagaattatta
acagaaatttctgatatgtcacctagactttcactttctgaaaagtctttaaaacgtaca
ccaagtttctcagtcaatcgtcctggcgaagaaacaggtgtaacatttgcaggtattcca
ttaggtcacgagtttaactcacttgttttagcaattttacaggttagtggtcgtgcacct
aaagaaaaacagtcaatcattgaccaaattaaaaacttagaaggttcattccattttgaa
acattcattagtttaacatgtcaaaaatgtcctgatgtcgttcaagcacttaacttaatg
agtgtgatcaaccctaacatcacgcattctatgattgatggtgcagtgttccgtgaagaa
tctgaaaacatcatggcagtccctgctgtctttttaaatggcgaagaatttggcaatggt
cgtatgacaatccaagatattctttcgaaactaggcagtacggcagatgcatctgagttt
gaaaacaaagaaccttatgatgtcttaatcgttggtggtggtcctgctagtggtagtgca
gcgatttacacagcacgtaaaggtttacgtactggtatagttgctgatcgtatcggtggc
caagttaatgatactgctggtattgagaacttcattactgttaaagaaacaactggttct
gaattttcttctaacttagcagcgcacattgatcaatatgacattgatgcaatgacaggt
atacgtgctacagatatcgaaaagactgacgaagcaattaaagttacgttagaaaacggt
gctgtcttagaaagtaaaacagtcattatcgctactggtgcaggttggcgtaagctaaac
attccaggtgaagagcaattgattaataaaggtgttgcattctgccctcactgtgacgga
cctctatttgaaaataaagacgtagcagttatcggtggcggtaactctggggttgaagca
gcaattgaccttgctggtatagttaatcatgttacattattcgaattcgctagcgaatta
aaagcagacaacgtgttacaagatcgtttacgttctttaccaaatgttgatatcaaaaca
aatgccaaaactactgaagttgtcggagaagaccatgttacaggtatacgttacgaagac
atgagcaccggcgaagaacatctacttaacttagatggtatctttgttcaaattggttta
cttccaaacacatcatggttaaaagatgctgttgaattaaacgaacgtggtgaaattgtt
attgatcgtaacaataatactaacgtacctggaatatttgctgctggcgatgtcacagat
cagaagaacaaacaaattattatttcaatgggcgctggtgcaaatgcagcattaaatgcc
tttgactatattatcagaaactaa

DBGET integrated database retrieval system