KEGG   Sulfitobacter sp. D7: B5M07_00010
Entry
B5M07_00010       CDS       T05714                                 

Definition
(GenBank) DNA polymerase III subunit beta
  KO
K02338  DNA polymerase III subunit beta [EC:2.7.7.7]
Organism
suld  Sulfitobacter sp. D7
Pathway
suld03030  DNA replication
suld03430  Mismatch repair
suld03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:suld00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    B5M07_00010
   03430 Mismatch repair
    B5M07_00010
   03440 Homologous recombination
    B5M07_00010
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:suld03032]
    B5M07_00010
   03400 DNA repair and recombination proteins [BR:suld03400]
    B5M07_00010
Enzymes [BR:suld01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     B5M07_00010
DNA replication proteins [BR:suld03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     B5M07_00010
DNA repair and recombination proteins [BR:suld03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     B5M07_00010
SSDB
Motif
Pfam: DNA_pol3_beta DNA_pol3_beta_2 DNA_pol3_beta_3
Other DBs
NCBI-ProteinID: AYE84622
UniProt: A0A386T8U1
LinkDB
Position
1626..2744
AA seq 372 aa
MKFSIERAALLKAVSQAQSVVERRNTIPILANVLIEAEGSDVSFRATDLDIEVVDKVSAQ
VERAGATTVSATLLHEIVRKLPDGALISLTADTAAGRLTVEAGRSNFSLATLPREDFPVM
ASSEYASNFAAPAPVLRRLFDKSKFAISTEETRYYLNGVYLHIADAEGGKALRCVATDGH
RLARIDAEMPEGAAEMPGVIVPRKTVGELRKLLDDDEMEIAVSVSETKIRFATPAITLTS
KVIDGTFPDYTRVIPQGNTRKMEVDAADFARAVDRVATVSSERSRAVKLQLDEDRLVLSV
NAPDSGAAEEELAVAYADERLEIGFNAKYLLEIASQVDRENAVFLFNSSGDPTLMREGND
TSAVYVVMPMRV
NT seq 1119 nt   +upstreamnt  +downstreamnt
atgaaattcagcatcgaacgcgcggcactgctcaaggccgtttcgcaagcccaatccgtg
gtcgagcgccgcaacaccattccgatcctcgccaacgtgctgatcgaggccgagggcagc
gatgtttccttccgcgccaccgatctggatatcgaagtggtcgacaaggtctccgcgcag
gttgagcgcgctggcgccaccaccgtttcggccacgctgctgcatgaaatcgtgcgcaaa
ctgcccgatggcgcgttgatcagcctgaccgccgataccgccgctggccgcctgactgtc
gaagcgggccgctcgaacttctcgctggcgaccctgccgcgtgaggacttccccgtgatg
gcgtcctcggaatatgcctcgaacttcgcggcccctgccccggtgctgcgccgcctgttc
gacaagtcgaaatttgccatctccaccgaagagacgcgctattacctgaacggtgtctac
ctgcatatcgcggatgccgaaggcggcaaggcgctgcgctgcgtggcgaccgatggtcac
cgcctcgcccggatcgacgccgagatgcccgagggtgcggctgaaatgcccggcgtcatc
gtgccgcgcaaaaccgtgggcgaattgcgcaagctgctggatgatgacgagatggaaatc
gcggtgtccgtgtcggagaccaagatccgtttcgccacccccgccatcaccctgacctcc
aaggtcatcgacggcaccttccccgattacacccgcgtgatcccacagggaaacacccgc
aagatggaagtcgacgccgcggatttcgcccgtgcggtggaccgtgtggcgaccgtgagt
tccgagcgttcgcgcgccgtaaaactgcaactggacgaagaccgtctggtgctgtccgtc
aacgcgcctgacagcggcgccgccgaagaagagctggccgtggcctatgccgacgagcgg
ctggagattggtttcaacgccaaatacctgcttgagatcgcaagccaagtggaccgcgag
aacgccgtcttcctgttcaactcctctggcgacccgaccctgatgcgcgaaggcaatgac
acttcggcggtttacgtcgtcatgccgatgcgcgtgtga

DBGET integrated database retrieval system