KEGG   Streptococcus suis S735 (serotype 2): YYK_07840
Entry
YYK_07840         CDS       T02214                                 

Definition
(GenBank) pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component-like protein
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
sup  Streptococcus suis S735 (serotype 2)
Pathway
sup00010  Glycolysis / Gluconeogenesis
sup00020  Citrate cycle (TCA cycle)
sup00260  Glycine, serine and threonine metabolism
sup00280  Valine, leucine and isoleucine degradation
sup00310  Lysine degradation
sup00380  Tryptophan metabolism
sup00620  Pyruvate metabolism
sup00630  Glyoxylate and dicarboxylate metabolism
sup00640  Propanoate metabolism
sup01100  Metabolic pathways
sup01110  Biosynthesis of secondary metabolites
sup01120  Microbial metabolism in diverse environments
sup01200  Carbon metabolism
Module
sup_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sup00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YYK_07840
   00020 Citrate cycle (TCA cycle)
    YYK_07840
   00620 Pyruvate metabolism
    YYK_07840
   00630 Glyoxylate and dicarboxylate metabolism
    YYK_07840
   00640 Propanoate metabolism
    YYK_07840
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    YYK_07840
   00280 Valine, leucine and isoleucine degradation
    YYK_07840
   00310 Lysine degradation
    YYK_07840
   00380 Tryptophan metabolism
    YYK_07840
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sup04147]
    YYK_07840
Enzymes [BR:sup01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     YYK_07840
Exosome [BR:sup04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   YYK_07840
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Biotin_lipoyl Pyr_redox Pyr_redox_3 FAD_oxidored FAD_binding_2 NAD_binding_8 HI0933_like GIDA FAD_binding_3 3HCDH_N DAO Thi4 Biotin_lipoyl_2 Trp_halogenase Lycopene_cycl UDPG_MGDP_dh_N
Other DBs
NCBI-ProteinID: AFR01079
LinkDB
Position
complement(1620659..1622419)
AA seq 586 aa
MAIEIIMPKLGVDMQEGEIIEWKKQEGDFVNEGDVILEMMSDKTSMELEAEESGVLLKIV
HGNGATVPVTEVIAYLGAEGESVEVGAALAPAEVAQATADLKAAGLEVPATPAAAPQAPK
AELAADEYDMVVVGGGPAGYYAAIRGAQLGGKIAIVEKSEFGGTCLNKGCIPTKTYLKNA
EILDGLKIAAERGINLASTNYTVDMDKTVDFKNKVVKTLTGGVQGLLKANKVTIFNGLGQ
VNPDKTVVIGDKVIKGRSIILATGSKVSRINIPGIDSKLVLTSDDILDLREIPKSLTVMG
GGVVGVELGLVYASYGTEVTVVEMADRIIPGMDREVSVELQKVLSKKGMKFLTSVGVSEI
VEANNQLTIKLNDGSEIVSEKALLSIGRVPQLAGLENLNLELDRGRIKVNEYQETSIPGI
YAPGDVNGTKMLAHAAYRMGEVAAENAIHGNHHKAKLDFTPAAVYTHPEIAMVGLTEDQA
IEKYGKENILIGRNSFTGNGRAIASNEAHGFVKVIADKKYHEILGVHIIGPVAAEMINEA
ATIMESELTVDDVAASIHGHPTFSEVMYEAFLDVLGVAIHNPPKRK
NT seq 1761 nt   +upstreamnt  +downstreamnt
atggcaattgaaattattatgccgaaacttggtgtagatatgcaagaaggcgaaatcatc
gagtggaaaaaacaagagggcgattttgtcaacgaaggcgatgttatcttggagatgatg
tcagataagacaagtatggaattggaagcggaagaatcaggtgttcttttgaaaatcgtt
catggcaacggtgcaacagttcctgtaacagaagtcattgcctaccttggtgcagaaggc
gaatcagttgaagtgggtgctgcactagctccagctgaggttgctcaagcaactgctgac
ttgaaagcagctggtttggaagttcctgcaacacctgcagcagctccacaagctcctaag
gctgaattggcagcagacgagtatgacatggttgttgtcggtggtggtcctgctggttac
tacgctgctatccgcggtgctcaattgggcggtaaaatcgctatcgttgagaaatcagaa
tttggcggtacctgcttgaacaagggttgtatcccaactaagacttacctcaaaaacgct
gaaatccttgacggcttgaagattgcggctgagcgtggtatcaaccttgcttcaacaaac
tataccgttgatatggacaagacagttgacttcaagaacaaggttgtgaagacattgact
ggtggcgttcaaggtctcttgaaagctaacaaggtaacaatcttcaacggtcttggtcaa
gtgaatcctgacaagactgttgtcatcggcgacaaggtcatcaaaggtcgtagcatcatc
cttgcaacaggttctaaagtatcacgcatcaatatcccaggtattgattctaagttggta
ttgacttctgatgatatccttgacttgcgtgaaattcctaagtcacttactgttatgggt
ggtggcgtagtcggtgtagaacttggtttggtttacgcatcatacggcacagaagtaacc
gttgttgaaatggctgaccgtatcattccaggtatggaccgcgaagtgtctgttgaattg
caaaaagtcctttctaagaaaggtatgaaattcttgacatctgttggtgtatctgaaatc
gtcgaagccaacaaccaattgacaatcaagttgaatgacggctcagaaatcgtttctgaa
aaagcccttctttcaatcggtcgtgtaccacaattggctggtcttgaaaatcttaacctt
gaactagaccgcggtcgtatcaaggttaacgaataccaagaaacatcaatcccaggtatc
tacgcaccaggtgatgtcaacggtactaagatgttggctcacgctgcttaccgtatgggt
gaagtggcagctgaaaatgccatccatggtaaccaccacaaggctaaattagacttcaca
ccagcagcggtttacacacacccagaaatcgctatggttggtttgacagaagaccaagct
atcgagaaatacggtaaagaaaacatccttatcggtcgcaatagcttcactggtaacggt
cgtgctattgcttctaacgaagcccatggtttcgtaaaagttatcgctgataagaaatac
catgaaatccttggggttcacatcatcggtccagttgcagctgaaatgatcaacgaagca
gcaactatcatggaatctgaattgactgttgatgatgtggcagcatcaatccacggtcac
ccaaccttctcagaggttatgtatgaagcctttcttgatgttcttggtgttgcaatccac
aacccaccaaaacgcaaataa

DBGET integrated database retrieval system