KEGG   Staphylococcus aureus subsp. aureus T0131 (MRSA): SAT0131_00413Help
Entry
SAT0131_00413     CDS       T01888                                 

Definition
(GenBank) Alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
sut  Staphylococcus aureus subsp. aureus T0131 (MRSA)
Brite
KEGG Orthology (KO) [BR:sut00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SAT0131_00413
Enzymes [BR:sut01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     SAT0131_00413
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 HI0933_like Thi4 FAD_binding_2 DAO AlaDh_PNT_C FAD_oxidored FAD_binding_3 K_oxygenase NAD_binding_9 NAD_binding_8 Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: AEB87510
LinkDB All DBs
Position
complement(409654..411177)
Genome map
AA seq 507 aa AA seqDB search
MLNADLKQQLKQLLELMEGNVEFVASLGSDDKSKELKDLLTEITDMSPRLSLSEKSLKRT
PSFSVNRPGEETGVTFAGIPLGHEFNSLVLAILQVSGRAPKEKQSIIDQIKKLEGSFHFE
TFISLTCQKCPDVVQALNLMSVINPNITHSMIDGAVFREESENIMAVPAVFLNGEEFGNG
RMTIQDILSKLGSTADASEFENKEPYDVLIVGGGPASGSAAIYTARKGLRTGIVADRIGG
QVNDTAGIENFITVKETTGSEFSSNLAAHIDQYDIDAMTGIRATDIEKTDEAIKVTLENG
AVLESKTVIIATGAGWRKLNIPGEEQLINKGVAFCPHCDGPLFENKDVAVIGGGNSGVEA
AIDLAGIVNHVTLFEFASELKADNVLQDRLRSLSNVDIKTNAKTTEVVGEDHVTGIRYED
MNTGEEHLLNLDGIFVQIGLLPNTSWLNDAVELNERGEIVIDRNNNTNVPGIFAAGDVTD
QKNKQIIISMGAGANAALNAFDYIIRN
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgcttaatgctgatttaaaacaacaacttaaacaactattagaactaatggagggcaac
gttgaattcgttgccagccttggttcagatgataaatccaaagaacttaaagatttgttg
acagaaattactgatatgtcacctagactatctctttctgaaaaatctttaaaacgtaca
ccaagtttctcagtcaatcgtcctggcgaagaaacaggtgtaacatttgcaggtattcca
ttaggtcacgagtttaactcacttgttttagcaattttacaggttagtggtcgtgcacct
aaagaaaaacagtcaatcattgaccaaattaaaaaattagaaggttcattccattttgaa
acattcattagtttaacgtgtcaaaaatgtcctgatgtcgttcaagcacttaacttaatg
agtgtgatcaaccctaacatcacgcattctatgattgatggtgcagtgttccgtgaagaa
tctgaaaacatcatggcagtccctgctgtctttttaaatggcgaagaatttggcaatggt
cgtatgacaatccaagatattctttcgaaactaggcagtacggcagatgcatctgagttt
gaaaataaagaaccttatgatgtcttaatcgttggtggtggtcctgctagtggtagtgca
gcgatttacacagcacgtaaaggtttacgtactggtatagttgctgatcgtatcggtggc
caagttaatgatactgctggtattgagaacttcattactgttaaagaaacaactggttct
gaattttcttctaacttagcagcgcacattgatcaatatgacattgatgcaatgacaggt
atacgtgctacagatatcgaaaagactgacgaagcaattaaagttacgttagaaaacggt
gctgtcttagaaagtaaaacagtcattattgctactggtgcaggttggcgtaagctaaac
attccaggtgaagagcaattgattaataaaggtgttgcattctgccctcactgtgacgga
cctctatttgaaaataaagacgtagcagttatcggtggcggtaactctggggttgaagca
gcaattgaccttgctggtatcgttaatcatgttacattattcgaattcgctagcgaatta
aaagcagacaacgtgttacaagatcgtttacgttctttatcaaatgttgatatcaaaaca
aatgccaaaactactgaagttgtcggagaagaccatgttacaggtatacgttacgaagac
atgaacaccggcgaagaacatctacttaacttagatggtatctttgttcaaattggttta
cttccaaacacatcatggttaaacgatgctgttgaattaaacgaacgtggtgaaattgtg
attgatcgtaacaataatacgaatgttcctggaatatttgctgctggcgatgtcacagat
cagaagaacaaacaaattatcatttcaatgggcgctggtgcaaatgcagcattaaatgcc
tttgactatattatcagaaactaa

DBGET integrated database retrieval system