KEGG   Sutterella faecalis: FG381_07470Help
Entry
FG381_07470       CDS       T06027                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
sutk  Sutterella faecalis
Brite
KEGG Orthology (KO) [BR:sutk00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    FG381_07470 (ahpF)
Enzymes [BR:sutk01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     FG381_07470 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored HI0933_like Thi4 DAO FAD_binding_2 FMO-like FAD_binding_3 Glutaredoxin K_oxygenase NAD_binding_8 NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: QDA54796
UniProt: A0A5B7ZK16
LinkDB All DBs
Position
1811640..1813199
Genome map
AA seq 519 aa AA seqDB search
MLDASALQQVKGYLDRLTGPITLTIAPDGSSESGQIQSLLKDVASVSGKITLATEDVSAQ
VRRPSFTVSRTGEKMGVRFAALPMGHEFSSFILAMLQASGYPSKEDPDLLERVRSLKGKY
DFEIYMSLSCHNCPDVVQALNLMAILNPNVSVTVIDGALFQDEVKARHIMAVPTVYLNGA
PFISGRHELGEIVAKLDEGFVKAQAEKLSAKAPFDILVVGAGPAGATAAIYAARKGLRTG
VVCERPGGQVNETSSIENFTSILMTDGVALGNRFMEHVNHYGVDVMALERVVKLEKNGEY
WEVELSSGAKLQTKAVIVCSGARWRQLGVPGEKEYQGHGVAYCPHCDGPLFKGKDVVVVG
GGNSGVEAAIDLAALCRSVTLLQRGGKLTADEVLVKRLESTSNAKIVYNLDIEKLEGDGT
VLTGVTYRERATGELRTVSAAGCFVQIGLVPNTDFLKGTVELTKWGEIVVDAHGAASAEG
IFAGGDCTAVPYKQVVIALGGGATAALGAFDWLIRQETK
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgcttgatgcctccgctctccagcaggtcaagggctatcttgaccgtctcaccggcccg
atcacgctcaccattgctccggatggttcttccgaatccggccagattcaatccctcctg
aaggatgtcgcctcggtttcgggcaagatcactcttgccaccgaagacgtcagcgcccag
gttcgccgtccgagcttcacggtaagccgcaccggtgaaaaaatgggcgtgcgctttgcc
gcgctcccgatgggccatgaattctcgtccttcatcctcgccatgcttcaggcgagcggc
tatccgagcaaagaggatccggaccttcttgagcgcgtccgcagcctcaagggcaagtac
gacttcgagatctacatgtctctctcgtgccataactgccccgacgttgtgcaggcgctc
aacctgatggcgatcctgaatccgaacgtttccgtcactgtgattgacggcgcgcttttc
caggacgaagtgaaggcccgccacatcatggccgtgccgaccgtctatctgaacggcgct
cccttcatttccggccgtcacgagctcggcgaaatcgtcgccaagcttgacgaaggcttc
gtcaaggctcaggccgagaagctctccgccaaggcgcccttcgacattctcgtcgtcggc
gccggccccgcgggcgccactgctgcgatttatgccgcccgcaagggccttcgcaccggc
gtcgtctgcgaacgcccgggcggacaggtgaatgaaacctcttcgatcgaaaacttcacg
tccatcctgatgacggacggcgttgcgctcggcaaccgcttcatggagcacgtcaaccat
tacggcgtcgacgtgatggcgctcgaacgcgttgtgaagctcgaaaagaacggcgaatac
tgggaagtcgaactttcgagcggcgcgaagctccagaccaaagccgttatcgtctgctcc
ggcgcccgctggcgccagctcggcgttccgggtgaaaaggaataccagggccacggcgtc
gcctactgcccgcactgcgacggtcctctcttcaagggcaaggacgttgtcgttgtaggc
ggcggcaattccggcgttgaggcggcgattgaccttgccgcgctctgccgctccgtcacg
ctgctgcagcgcggcggcaagctcactgcggacgaagttctcgtgaagcgtcttgaatcc
acttcgaacgccaagatcgtctacaacctcgacattgagaagctcgaaggcgacggcacg
gtgctgaccggcgtcacctaccgcgagcgcgccacgggcgaactgcgtacggtttcggcc
gctggctgcttcgtgcagattggtcttgtgcccaatacggacttcctcaagggcacggtt
gagctcaccaagtggggcgaaatcgtggtcgacgcgcacggcgccgcttctgcggaaggc
attttcgccggcggcgactgcacggccgttccctataagcaggtcgtcattgcacttggc
ggcggagccaccgcggcgctcggcgccttcgactggctgatccgtcaggaaaccaagtaa

DBGET integrated database retrieval system