KEGG   Streptomyces venezuelae: SVEN_3266Help
Entry
SVEN_3266         CDS       T02274                                 

Definition
(GenBank) Glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
sve  Streptomyces venezuelae
Pathway
sve00250  Alanine, aspartate and glutamate metabolism
sve00410  beta-Alanine metabolism
sve00430  Taurine and hypotaurine metabolism
sve00650  Butanoate metabolism
sve01100  Metabolic pathways
sve01110  Biosynthesis of secondary metabolites
sve01120  Microbial metabolism in diverse environments
sve02024  Quorum sensing
Module
sve_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sve00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    SVEN_3266
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SVEN_3266
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SVEN_3266
   00430 Taurine and hypotaurine metabolism
    SVEN_3266
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    SVEN_3266
Enzymes [BR:sve01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     SVEN_3266
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: CCA56552
UniProt: F2RA70
LinkDB All DBs
Position
3577511..3578932
Genome map
AA seq 473 aa AA seqDB search
MPLHQGPAASPAGRERRLALNPFFGEAANPVGGMTEAPPHHRMPDGPLPPMSAYQLVHDE
LMLDGNSRLNLATFVTTWMEPQAGVLMSECRDKNMIDKDEYPRTAELERRCVAMLADLWH
APDPGAAVGCSTTGSSEACMLAGMALKRRWTKRNADRYPGSARPNLVMGVNVQVCWEKFC
NFWEVEPRLVPMEGDRFHLDAESAAALCDENTIGVVAVLGSTFDGSYEPVAEICAALDAL
QERTGLDIPVHVDGASGAMIAPFLDEDLVWDFRLPRVSSINTSGHKYGLVYPGVGWALWR
SAAELPEELVFRVNYLGGDMPTFALNFSRPGAQVVAQYYTFLRLGREGYRAVQQTSRDIA
RGLAERIEAMGDFRLLTLGNQLPVFAFTTASDVTNFNVFDVSRRLREHGWLVPAYTFPEN
REDLSVLRVVCRNGFSADLAGLLIEDLSRLLPELRRQSGPFTHDKDAATSFHH
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgccgctccaccagggtcccgccgcctcccccgccgggcgcgagcgccggctcgccctc
aaccccttcttcggggaggccgccaacccggtcggcggtatgaccgaggccccgccccac
caccggatgcccgacggcccgctccccccgatgagcgcctaccagctcgtccacgacgag
ctgatgctcgacggcaactcccggctcaacctcgccaccttcgtcaccacctggatggaa
ccccaggcgggcgtgctcatgagcgagtgccgcgacaagaacatgatcgacaaggacgag
tacccgcgcaccgccgaactggagcgccgctgcgtcgccatgctcgccgacctctggcat
gcccccgacccgggcgcggccgtcggctgctccaccaccggctccagcgaggcctgcatg
ctcgccggcatggccctgaaacgccgctggaccaagcggaacgccgaccgctacccgggc
tccgcccgccccaacctggtcatgggggtcaacgtccaggtctgctgggagaagttctgc
aacttctgggaggtcgagccccgcctcgtccccatggagggcgaccgcttccacctcgac
gccgagtccgccgccgcgctctgcgacgagaacaccatcggagtcgtcgccgtcctcggc
tcgaccttcgacggctcctacgaacccgtcgccgagatctgcgccgccctggacgccctc
caggaacgcaccggactcgacatccccgtccacgtcgacggcgcctccggcgccatgatc
gcccccttcctcgacgaggacctggtctgggacttccggctcccccgcgtctcctcgatc
aacacctccggtcacaagtacggcctggtctacccgggcgtcggctgggccctgtggcgc
tccgccgccgaactccccgaggagctcgtcttccgcgtcaactacctgggcggcgacatg
cccaccttcgccctcaacttctcccggccgggcgcccaggtcgtcgcgcagtactacacg
ttcctgaggctcggccgggagggctaccgggcggtgcagcagacctcccgggacatcgcc
cgcggcctcgccgaacggatcgaggccatgggcgacttccggctcctcaccctcggcaac
cagctgcccgtcttcgccttcaccaccgcatccgacgtcaccaacttcaacgtcttcgac
gtctcccggcgcctgcgcgaacacggctggctcgtccccgcttacacgttccccgagaac
cgcgaggacctgtccgtcctgcgcgtggtctgccgcaacggcttctccgccgacctcgcc
gggctcctcatcgaggacctgagccggctactgcccgaactgcgccgccagtccggcccg
ttcacccacgacaaggacgccgcgacctccttccaccactag

DBGET integrated database retrieval system