KEGG   Streptomyces violaceusniger: Strvi_1092Help
Entry
Strvi_1092        CDS       T01602                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
svl  Streptomyces violaceusniger
Pathway
svl00010  Glycolysis / Gluconeogenesis
svl00620  Pyruvate metabolism
svl00630  Glyoxylate and dicarboxylate metabolism
svl00640  Propanoate metabolism
svl00680  Methane metabolism
svl01100  Metabolic pathways
svl01110  Biosynthesis of secondary metabolites
svl01120  Microbial metabolism in diverse environments
svl01130  Biosynthesis of antibiotics
svl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:svl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Strvi_1092
   00620 Pyruvate metabolism
    Strvi_1092
   00630 Glyoxylate and dicarboxylate metabolism
    Strvi_1092
   00640 Propanoate metabolism
    Strvi_1092
  09102 Energy metabolism
   00680 Methane metabolism
    Strvi_1092
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:svl01004]
    Strvi_1092
Enzymes [BR:svl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Strvi_1092
Lipid biosynthesis proteins [BR:svl01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Strvi_1092
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding DUF58 DUF2058
Motif
Other DBs
NCBI-ProteinID: AEM80852
UniProt: G2P094
LinkDB All DBs
Position
918580..919155
Genome map
AA seq 191 aa AA seqDB search
MPFAPVRKKTAVPRTSRTEELPTLAADTRRAARVALRWISEPDCTEELTHAELLDQAARA
AAALTRLGVRAGDRVAVHLPLVPESVIATLACGRLDVVRASLPVGLRPHELRERIREVDA
KVVITADAGQHRGELQPLKRQVDRALAGCPGVRSVLVVHRLACPVSWTPGRDLWWHDELG
RYTEPLPGPYS
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgccgttcgcccccgtccgaaagaagaccgccgtgccccgtacgtctcggacggaggag
ctcccgacactggccgccgacactcggcgggccgcccgggtcgccctccgctggatcagc
gagccggactgcaccgaggagctcacccatgccgagctgctcgaccaggcggcccgggcc
gccgccgcactcacccggctcggcgtccgcgccggggaccgggtggcggtccatctgccg
ctggtgcccgagtccgtgatcgccacgctcgcctgcggccggctcgacgtcgtccgcgcc
agcctccccgtggggctgcgcccccatgagctgcgcgagcggatcagggaggtcgacgcg
aaggtcgtcatcaccgcggacgccgggcagcaccgcggggagctgcagccgctcaagcgg
caggtcgaccgggcgctggccggctgccccggggtgcggtccgtgctggtcgtgcaccgg
ctggcctgcccggtgtcctggacgcccgggcgtgacctgtggtggcacgacgagctcggc
cgatacaccgagccgctgcccgggccgtactcttga

DBGET integrated database retrieval system