KEGG   Streptomyces violaceusniger: Strvi_8625Help
Entry
Strvi_8625        CDS       T01602                                 

Definition
(GenBank) tryptophanyl-tRNA synthetase
  KO
K01867  tryptophanyl-tRNA synthetase [EC:6.1.1.2]
Organism
svl  Streptomyces violaceusniger
Pathway
svl00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:svl00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Strvi_8625
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:svl01007]
    Strvi_8625
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:svl03016]
    Strvi_8625
Enzymes [BR:svl01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.2  tryptophan---tRNA ligase
     Strvi_8625
Amino acid related enzymes [BR:svl01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   Strvi_8625
Transfer RNA biogenesis [BR:svl03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Strvi_8625
 Prokaryotic type
    Strvi_8625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1b
Motif
Other DBs
NCBI-ProteinID: AEM87933
UniProt: G2P1I4
LinkDB All DBs
Position
complement(9939956..9940969)
Genome map
AA seq 337 aa AA seqDB search
MALDRPRALSGIQPTAGSFHLGNYLGAIRQYVALQETHDAFYTVVDLHAITVPQDPAELR
ANSRLAAAQLLASGLDPDRCTLFIQSHVPEHAQLGWVMNCLTGFGEASRMTQFKDKSARH
GADRATVGLFTYPILQVADILLYQANHVPVGEDQRQHIELTRDLADRFNGRFGETFTVPE
AYIVKETGKIYDLQDPTIKMSKSASTPKGIVSLLDEPKVSAKKIKSAVTDLETEIRYDEE
KKPGVSNLLTIYSTLTGTSIPELESRYEGKGYGALKTELSEVLVEWVTPFRERTQEYLAD
PATLDGILAKGAEKARAVAAETLAAAYDKVGFLPPAR
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggccctcgatcgtccccgtgcgctctccggtatccagcccaccgcaggttccttccac
ctcggcaactacctcggtgcgatccggcagtacgtcgcgctgcaggagacccacgacgcg
ttctacaccgtggtcgatctgcacgcgatcaccgtgccgcaggatccggcggagctgcgc
gccaacagccggctcgccgccgcccagctcctcgcctccggcctggacccggaccgctgc
acgctcttcatccagagccatgtgcccgagcacgcccagctcgggtgggtgatgaactgt
ctcaccggcttcggcgaggcgtcccggatgacgcagttcaaggacaagtcggccaggcac
ggcgccgaccgggccaccgtcggcctcttcacctatccgatcctgcaggtcgcggacatc
ctgctctaccaggccaatcacgtcccggtcggcgaggaccagcgccagcacatcgagctc
acccgggatctggccgaccgcttcaacggccgcttcggcgagaccttcaccgtccccgag
gcgtacatcgtcaaggagacggggaagatctacgacctccaggacccgacgatcaagatg
agcaagtcggcgtccacgccgaagggcatcgtcagcctcctcgacgagcccaaagtctcc
gcgaagaagatcaagagcgcggtgaccgacctcgagacggagatccgctacgacgaggag
aagaagccgggcgtcagcaatctgctgaccatctactccaccctgaccggcacctccatc
ccggagttggagagccgttacgagggcaagggctacggcgcgctcaagaccgagctctcc
gaggtgctggtcgagtgggtcacgccgttccgcgagcggacccaggaatacctcgccgac
cccgcgacgttggacggaatcctggccaagggcgccgagaaggcccgagccgtcgccgcc
gagacgctggccgccgcctacgacaaggtgggcttcctgccccccgcgcgctga

DBGET integrated database retrieval system