KEGG   Shewanella violacea: SVI_2416Help
Entry
SVI_2416          CDS       T01206                                 

Gene name
ddlA
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
svo  Shewanella violacea
Pathway
svo00473  D-Alanine metabolism
svo00550  Peptidoglycan biosynthesis
svo01100  Metabolic pathways
svo01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:svo00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    SVI_2416 (ddlA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SVI_2416 (ddlA)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    SVI_2416 (ddlA)
Enzymes [BR:svo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SVI_2416 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:svo01011]
 Precursor biosynthesis
  Amino acid ligase
   SVI_2416 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 RimK Glyco_hydro_36
Motif
Other DBs
NCBI-ProteinID: BAJ02387
UniProt: D4ZL38
LinkDB All DBs
Position
2774733..2775743
Genome map
AA seq 336 aa AA seqDB search
MSQTNLLLICGGGGDEHAISLMSAKFFETSLAKLAHINLLKIELDAQGHYRTQAGELCEL
TNRKQIRFDDVNKASWPVDYVIPCIHGYPGETGDIQSYFELIKLPYFGCDSEASRNCFNK
VTAKMWFSALGIPNTPYIFLNDFNDDAINQAQQALASWGSIFIKAASQGSSVGCYRVDSP
EELTESLKQAFTYSPYVIVEKTIEARELEVAVYEKDGEIIATQPGEIICGTNTFYTFDEK
YAENSQAETKVVADISESVSQEIREYAVKVFKGMKLSHLSRIDFFLTADNEILLNEINTF
PGLTPISMFPKMLQNHGDNFSDYLNHNIMQQLSKKD
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaacaaatctactgttaatatgtggtggcggtggggatgaacacgcaatctca
ctgatgtcagccaagttttttgagacttcactggccaaattagcccatataaacctatta
aaaatcgaactcgacgcacagggacattatcgaacccaagcaggtgaactctgtgaattg
accaatcgtaaacagatacgtttcgatgacgttaataaggcgtcctggccggtagattac
gtcattccctgtattcacggttatccgggagaaaccggtgacattcaatcttatttcgaa
ctgatcaagttaccctatttcggttgcgattcagaagcgagccgtaattgcttcaacaag
gtcaccgctaagatgtggttctcggcccttggcatccccaataccccctatattttcctc
aatgactttaacgatgacgccatcaatcaagctcagcaggctttagcctcttggggctcg
atattcatcaaggccgcgtcacaaggatcatctgttggttgttaccgtgtagacagcccg
gaagaattaactgagtcattgaagcaagcgttcacctattcgccctatgtcatcgtcgag
aagaccattgaagccagagagttggaagtggccgtatatgagaaagatggtgagattatc
gcaactcagccaggtgagataatctgcggaactaataccttttatactttcgatgaaaag
tacgccgagaacagccaagccgaaacgaaagtggttgccgatatcagtgagagtgtgagc
caggaaattcgtgagtatgcagtcaaggtattcaagggaatgaaactcagtcacctttct
cgtatcgatttcttcctcactgcggataatgaaattctcctcaatgaaattaataccttc
ccaggtctcactcccatctccatgttccctaagatgctacaaaatcatggtgacaatttc
agtgattaccttaaccacaacataatgcagcaactcagcaagaaagactga

DBGET integrated database retrieval system