KEGG   Shewanella woodyi: Swoo_2674Help
Entry
Swoo_2674         CDS       T00676                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
swd  Shewanella woodyi
Pathway
swd00473  D-Alanine metabolism
swd00550  Peptidoglycan biosynthesis
swd01100  Metabolic pathways
swd01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:swd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Swoo_2674
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Swoo_2674
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Swoo_2674
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:swd01011]
    Swoo_2674
Enzymes [BR:swd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Swoo_2674
Peptidoglycan biosynthesis and degradation proteins [BR:swd01011]
 Precursor biosynthesis
  Amino acid ligase
   Swoo_2674
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 DUF4355 RimK
Motif
Other DBs
NCBI-ProteinID: ACA86950
UniProt: B1KI99
LinkDB All DBs
Position
3272758..3273837
Genome map
AA seq 359 aa AA seqDB search
MVAKNGDYAIVSQQLNIISGDQENMSQINLLLLCGGGGDEHAISLMSADFLETSLAKEPE
INLLRVELDGQGHYRTQDGRSCELTNRKEIRFAAEEQAPWPVDYVIPCIHGFPGETGDIQ
SYFDLIKLPFFGCDSESSSNCFNKVTAKMWFSALGVPNTPYIFLNELNQESIAQTKQALE
NWGSIFIKAASQGSSVGCYRVDSQDELVSSLEQAFSFSPYVIVEKTINARELEVAAYELN
GEIVATKPGEIICASNTFYSFDEKYAANSKAETKVEADVSEEVAQQIQAYAIKVFKGMKL
SHLSRIDFFLTEDNEILLNEINTFPGLTPISMFPKMLQNHGDDFTHYLYSNIKSQLVSA
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggttgcaaaaaatggcgattacgccatagtgagccagcaactgaatattatctctgga
gaccaagagaacatgagccaaattaacctactcttattgtgcggcggtggtggagacgag
catgcgatttcgcttatgtctgcagacttcctcgaaacctcattggctaaagagcctgag
ataaatctattaagagtagaactggacggtcagggacactaccgaacccaagatggcaga
agctgtgagctcaccaaccgcaaagagatccgttttgctgctgaggagcaagcgccctgg
cccgtcgattatgtgatcccctgtattcacggcttccctggtgaaactggtgatattcaa
tcttatttcgacttaatcaaactacccttctttggttgtgactctgaatcaagtagtaac
tgcttcaataaggtgacagcaaagatgtggttcagtgcccttggagtgccgaatactccc
tacatcttcctcaatgagttgaatcaagagtctatcgcacaaactaaacaagcactggaa
aactggggctcaatctttattaaggctgcatcacagggttcatctgttggttgttaccga
gtcgacagccaagatgaacttgtctcaagtttagagcaagcattcagcttctctccctat
gttattgttgaaaaaaccattaacgcccgagagctcgaagtcgcagcttatgagttaaat
ggtgagatagtggcaaccaaacctggtgagatcatctgcgctagtaacaccttctacagt
ttcgatgagaaatacgctgctaacagcaaagctgaaactaaagtagaggcggatgtcagt
gaagaggtagcccagcagatccaggcctatgccattaaagtgtttaaagggatgaagttg
agccatctttcacgtatagacttctttttaacagaagataatgaaattttactcaatgag
atcaatacctttcctgggctaacgcctatctcaatgttccctaagatgctgcaaaatcat
ggtgatgactttacccattacctctactcgaacataaagtcacagctcgtatcagcgtag

DBGET integrated database retrieval system