KEGG   Swingsia sp. F3b2: E3E12_00875
Entry
E3E12_00875       CDS       T06093                                 

Gene name
trxB
Definition
(GenBank) thioredoxin-disulfide reductase
  KO
K00384  thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
swf  Swingsia sp. F3b2
Pathway
swf00450  Selenocompound metabolism
Brite
KEGG Orthology (KO) [BR:swf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    E3E12_00875 (trxB)
Enzymes [BR:swf01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.9  thioredoxin-disulfide reductase
     E3E12_00875 (trxB)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA DAO FAD_oxidored FAD_binding_2 NAD_binding_7 HI0933_like FAD_binding_3 K_oxygenase Thi4 NAD_binding_9 NAD_binding_8 Shikimate_DH Trp_halogenase Attacin_N FMO-like
Other DBs
NCBI-ProteinID: QDH14265
UniProt: A0A4Y6UE23
LinkDB
Position
205931..206911
AA seq 326 aa
MAKAPTHHTDVLIIGSGPAGYTAAIYAARAERKPLLVAGMQPGGQLTITDEVENYPGFAK
PVSGPWLMEQMREQAERSGTRMEQDIITHCALKDGPDKDGYFHLEGDSGAQYRARTVIIA
TGASARWLGLDSEAKFKGHGVSACATCDGFFFKNREVAVVGGGNTAVEEALYLTRHAAKV
HLIHRREGLKAEKVLVDRLNKNDKIIPHWYREVEEIVGKAVVKGAPEVVTSVVLKDPRNP
AHKEVLAVDGVFVAIGHQPNSGPFRDQLRCDRDGYIETKPGTPETSVAGVFAAGDVQDRS
WRQAVTAAGTGCAAALAAERWLEERP
NT seq 981 nt   +upstreamnt  +downstreamnt
atggccaaagcgccaacacaccatacagatgtcctaatcattggttcagggcctgcaggc
tacacagctgccatttacgcagcgcgcgctgaacgcaagccccttctggtggcgggtatg
cagccaggcggccaactgaccatcacagatgaggttgagaactacccaggctttgccaag
cctgtctcggggccttggctgatggagcagatgcgtgaacaggctgaacgttcaggcaca
cgcatggaacaggacattatcacgcattgcgccttgaaagatggccccgacaaggacggc
tatttccatttagaaggtgattcaggcgcgcagtaccgcgcccgcaccgtcatcatcgcc
acaggggccagcgcccgttggctgggccttgattcggaggcgaagttcaaaggccatggc
gtttccgcctgtgccacctgtgacgggttctttttcaaaaacagggaagtggccgttgtc
ggcggtggcaacacagctgtggaagaggccctctacctcacccgccatgccgccaaggtg
cacctcattcaccgccgtgaggggctgaaggctgaaaaggtgttagtcgaccggctcaac
aaaaatgacaaaatcatcccccattggtaccgggaggttgaggagatcgtgggtaaagcc
gttgtcaaaggggcgccagaggtcgtcaccagcgtggttttgaaagacccgcgcaaccca
gcccacaaggaggtactggctgtggacggcgttttcgtagccattgggcaccaacccaat
tcaggccccttccgtgaccagctacgctgcgaccgcgatggttacattgaaaccaagcca
ggcacccctgaaaccagcgttgctggcgtgtttgcggcaggcgacgttcaggacagaagc
tggcgccaggcggtgacggcagctggcacaggctgtgcggccgctttggctgcggaacgt
tggctggaggagcgcccctga

DBGET integrated database retrieval system