KEGG   Swingsia sp. F3b2: E3E12_07465
Entry
E3E12_07465       CDS       T06093                                 

Definition
(GenBank) ubiquinone biosynthesis protein UbiH
  KO
K03185  2-octaprenyl-6-methoxyphenol hydroxylase [EC:1.14.13.-]
Organism
swf  Swingsia sp. F3b2
Pathway
swf00130  Ubiquinone and other terpenoid-quinone biosynthesis
swf01100  Metabolic pathways
swf01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:swf00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    E3E12_07465
Enzymes [BR:swf01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.-  
     E3E12_07465
SSDB
Motif
Pfam: FAD_binding_3 DAO SE Thi4 NAD_binding_8 Pyr_redox 3HCDH_N ApbA Pyr_redox_2 Pyr_redox_3 FAD_oxidored
Other DBs
NCBI-ProteinID: QDH14486
UniProt: A0A4Y6UDA8
LinkDB
Position
complement(1713661..1714989)
AA seq 442 aa
MAARSGAQQSSGGAFDVCINGAGPIGATIACLLARKGLRVAVVERNALPRAPRPELDGRA
YALAEGVIPLLAESGIWTRLPRQAEPITTIDIIDSAGRPVADGLPGGLLGRALRQNLDKV
TFTPGDAPEGHPFGWMVEAYDLLPAITHALEAARPAQPGAAGVTVFEQTEADFAFSPEGV
TISLSPAGQEGYGQESARTITAPLAIACDGRRSALREAAGIPLTVLPYGKHALVVPLVHE
RPHHGSALEHFLPEGPFARLPLPPGPGGEFRSALVWTDTPERIHHLATLPAEAFLRQAQK
RLGDRSLGALKLAGKRWRYPLTSQYAHRYKAERLLLAGDAAHGLHPVAGQGMNLGFRDVR
LIVRLLGEAFSQGADLGSPELLARYQRQARPEDFAMLVGCDVMERLFSSRNPVAITARRL
GMNVMARLPPLRRRFIAQAMGY
NT seq 1329 nt   +upstreamnt  +downstreamnt
ctggcagcccgctctggcgcccagcaaagcagtgggggtgcgtttgacgtttgcatcaac
ggcgctggtcccattggcgccaccatcgcctgccttttagcgcgcaaaggcctgcgcgtg
gcagtggtggaacgcaacgccctgccccgcgccccccggccagagcttgatgggcgcgcc
tacgctttggcggagggggtgataccccttttggcggaaagcggcatttggacgcgtctg
ccccgtcaagcagagcctatcaccaccattgacatcatcgattcagcaggccgccccgtg
gcggatggcctgccagggggcctgttggggcgcgcgttgcgccagaacctggacaaagtg
accttcaccccaggtgacgcccctgaaggccacccctttggctggatggtggaggcctac
gacctcctgccagccatcacccacgctttggaggccgcacgcccagcccagccaggcgct
gctggcgtgacggtgtttgagcagacggaggctgatttcgctttctccccagagggcgtg
accatcagcctatccccagcagggcaggaagggtatggccaggagagcgctcgcaccatc
acagcccccctggccatcgcttgcgatgggcgccgttccgccctgcgggaggcagctggc
attcccctcaccgtgctgccttacggcaagcacgccctagtggtaccccttgtgcatgaa
cgcccccaccatggcagcgcgctggagcatttcttgcctgaaggccccttcgcgcgcctc
cccctgccgcctggcccagggggcgagtttcgctcagctcttgtgtggacagacacgcca
gagcgcatccaccacctggccacgctgccagcggaggccttcctgcgccaagcccaaaag
cgccttggcgaccgctctctaggggcgctgaaactagctggcaagcgctggcgctacccg
ctgacctcccaatacgcccaccgctacaaggccgagcggctgttgctggcgggtgacgcc
gcccacggcctccaccctgtggcggggcagggcatgaatttggggttcagggacgtccgc
ctcatcgtgcgcctgttgggggaggctttcagccagggtgccgacctgggcagcccagaa
ctgctggcccgctaccagcgccaagcccggcctgaggacttcgccatgcttgtggggtgc
gatgtgatggaacgtctcttcagcagccgtaacccggtggccatcactgcgcgccgcctt
ggcatgaatgtcatggcgcgcctgccgccgctgcgccgccgcttcatcgcccaagccatg
ggctattga

DBGET integrated database retrieval system