KEGG   Shewanella piezotolerans: swp_2771Help
Entry
swp_2771          CDS       T00791                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
swp  Shewanella piezotolerans
Pathway
swp00473  D-Alanine metabolism
swp00550  Peptidoglycan biosynthesis
swp01100  Metabolic pathways
swp01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:swp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    swp_2771
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    swp_2771
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    swp_2771
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:swp01011]
    swp_2771
Enzymes [BR:swp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     swp_2771
Peptidoglycan biosynthesis and degradation proteins [BR:swp01011]
 Precursor biosynthesis
  Amino acid ligase
   swp_2771
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 RimK
Motif
Other DBs
NCBI-ProteinID: ACJ29498
UniProt: B8CMV8
LinkDB All DBs
Position
2908413..2909411
Genome map
AA seq 332 aa AA seqDB search
MSTTNILLLCGGGGDEHAISLLSANYFETSLATLPQFNVLRVELDVNGHYRTAAGESCEL
NSRRQIRFDADNRAPWEVDFAIPCIHGFPGETGDIQSYFELINLPYFGCKAEASRNCFNK
ITAKMWFSALNIPNTPYLFLNEMSDVSIEQATNALVNWGSIFVKAASQGSSVGCYRIDNQ
EDVASTLAQAFTYSDYVIVEKTISARELEVAVYEIDGEIVATVPGEVICSSNNFYTFDEK
YAANSKAQTQVVADISKEVSDLIRQYAISAFKGMKLRHLSRIDFFLTDDGEVLLNEINTF
PGLTPISMFPKMLQNHGHSFPDYLLSNINSTD
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgagtacaacgaatattttattactgtgcggtggtggcggagacgaacatgcaatatcc
cttttatcagcaaactattttgaaacttcgctagcgactctccctcaatttaatgtgcta
cgcgtcgaattagatgtaaatggtcattatcgaactgctgcaggcgaaagttgcgagcta
aatagccgcagacagatccgttttgacgctgataatagagccccctgggaagtcgatttt
gccattccttgtattcacggttttcctggtgaaactggcgatatccaatcttactttgaa
ctcatcaatctgccctacttcggctgtaaagcagaggcgagtcggaattgctttaataaa
attaccgcaaagatgtggtttagtgcgctcaacatccccaatactccctatctatttctc
aatgagatgagtgacgtttctatagaacaagcaactaacgcgcttgtaaattggggcagt
atttttgtaaaggcagcatctcaaggctcatcagttggctgttaccgcatcgataatcaa
gaagatgtggcgtcgacattagcacaagcgtttacttattcagattatgtcattgttgag
aaaaccattagtgctagagagctagaagttgctgtctacgagattgacggtgaaattgtc
gcaacggttcctggcgaagtgatctgttccagtaataacttttatactttcgatgaaaag
tatgcagctaatagcaaagcgcaaacacaagtcgtggcagatatctcaaaagaggtcagc
gacctgatccgccaatatgcaattagtgcttttaaaggtatgaagttaaggcatttatca
cgtatcgatttctttctaactgatgacggcgaagtactgctcaatgaaatcaataccttt
cctggactcacacctatctctatgtttcctaaaatgttacaaaaccatggccatagcttc
cctgactatttgttaagtaacattaacagcactgattaa

DBGET integrated database retrieval system