KEGG   Streptomyces xiamenensis: SXIM_33320Help
Entry
SXIM_33320        CDS       T03904                                 

Definition
(GenBank) glycerol phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
sxi  Streptomyces xiamenensis
Pathway
sxi00564  Glycerophospholipid metabolism
sxi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sxi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SXIM_33320
Enzymes [BR:sxi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     SXIM_33320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 FAD_binding_2 FAD_oxidored Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: AKG44716
UniProt: A0A0F7CPI4
LinkDB All DBs
Position
3569617..3571323
Genome map
AA seq 568 aa AA seqDB search
MKTATLGPGQRAEALARMAERELDILVVGGGVVGAGTALDAVTRGLATGIVEARDWASGT
SSRSSKLIHGGLRYLEMLDFALVREALKERGLLLGRIAPHLVKPVPFLYPLQHRGWERLY
AGSGVALYDTMALSSGHARGLPHHRHLTRRHALRVAPCLRKDALVGALQYYDAQMDDARY
VATLVRTAASYGALAANRTRVTEFLREGERVVGVKVLDLEGDEAYEVRAKQVVNATGVWT
DDTQGMIAERGQFHVTASKGVHLVVPKDRIQSSTGLILRTEKSVLFVIPWGRHWIVGTTD
TPWDLDKAHPAASSADIDYVLEHVNSVLAVPLTRDDVQGVYAGLRPLLAGESDATSQLSR
EHTVAHPVPGLVVVAGGKYTTYRVMAKDAVDAAVHGLDQRVAACCTEQVQLTGAEGYHAL
WNSRARIAARTGLHHTRVEHLLNRYGSMTEEILELIDADPSLGEPLPAADDYLKAEIVYA
CSHEQARHLEDVLTRRTRISIETFDRGTRSARECAELMAGVLGWDQQQIGREVEHYEKRV
EAERESQLQPDDQTADAARLGAPDTVPL
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
gtgaagacagcgaccctggggcccggccagcgggccgaggcactcgcccggatggcggaa
cgcgaactggacatcctggtggtgggtggcggcgtggtcggcgccggcaccgccctggac
gccgtgacccgcgggctcgccaccggcatcgtcgaggccagggactgggcgtccggcacc
tcctcccgctccagcaagctcatccacggcggcctgcgctacctggagatgctggacttc
gcgctggtgcgcgaggcactcaaggaacgcgggctgctgctcggccggatcgccccgcac
ctggtgaagccggtgccgttcctgtacccgctgcagcaccgcggctgggagcggctgtac
gccggcagcggcgtcgccctgtacgacaccatggccctgtcctcgggtcacgcccgcggc
ctgccgcaccaccggcacctcacccggcggcacgcgctgcgggtggcgccctgcctcagg
aaggacgccctcgtcggggccctccagtactacgacgcccagatggacgacgcgcggtac
gtcgccaccttggtccgtaccgccgcctcgtacggggcgctggccgccaaccggacgcgg
gtgaccgagttcctgcgcgagggcgaacgcgtggtcggcgtgaaggtgctcgacctggag
ggcgacgaggcgtacgaggtgcgcgccaaacaggtcgtcaacgccaccggggtgtggacc
gacgacacccaggggatgatcgccgaacgcggacagttccacgtcaccgcctccaagggc
gtccatctggtggtgcccaaggaccgcatccagtcctccactgggctgatcctgcgcacc
gagaagagcgtgctgttcgtcatcccgtggggacgccactggatcgtgggcaccacggac
accccctgggacctggacaaggcacacccggcggcctccagcgccgacatcgactacgtg
ctcgaacacgtcaactcggtgctggcggtaccgctgacgagggacgacgtccagggcgtg
tacgccgggctgcggcccctgctggcgggcgagtcggacgccaccagccagctgtcgcgc
gaacacaccgtggcccaccccgtaccgggcctggtggtcgtggcgggcggcaagtacacg
acgtaccgggtgatggccaaggacgccgtggacgcggccgtgcacggtctcgaccagcgg
gtcgccgcctgctgcaccgagcaggtccagctcaccggcgccgagggctaccacgcgctg
tggaactcccgggccaggatcgcggcgcgcaccgggctgcaccacacccgggtggagcac
ctgctcaaccgctacggctccatgaccgaggagatcctggagctgatcgacgccgacccc
tcgctcggcgagccgctgccggccgccgacgactacctcaaggccgagatcgtctatgcc
tgttcgcacgagcaggcccggcacctggaggacgtgctcacccggcgcacccggatctcg
atcgagacgttcgaccgggggacgcgcagcgcgcgcgagtgcgccgagctgatggccggc
gtcctgggctgggaccagcagcagatcgggcgcgaggtcgagcactacgagaagcgggtg
gaggcggagcgcgagtcgcagctccagcccgacgaccagacggcggacgcggcccggctg
ggggcgcccgacaccgtaccgctgtag

DBGET integrated database retrieval system