KEGG   Streptomyces xiamenensis: SXIM_35940
Entry
SXIM_35940        CDS       T03904                                 

Definition
(GenBank) DegT/DnrJ/EryC1/StrS aminotransferase
  KO
K13308  dTDP-4-amino-4,6-dideoxy-D-glucose transaminase [EC:2.6.1.33]
Organism
sxi  Streptomyces xiamenensis
Pathway
sxi00523  Polyketide sugar unit biosynthesis
sxi01100  Metabolic pathways
sxi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sxi00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    SXIM_35940
Enzymes [BR:sxi01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.33  dTDP-4-amino-4,6-dideoxy-D-glucose transaminase
     SXIM_35940
SSDB
Motif
Pfam: DegT_DnrJ_EryC1 Aminotran_1_2 Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP
Other DBs
NCBI-ProteinID: AKG44978
UniProt: A0A0F7FXX2
LinkDB
Position
complement(3833271..3834407)
AA seq 378 aa
MGRPTVGDRKRFLERLNGALDRQWLTNGGPLVHEFEDRVAEVAGTRHCVATSNATMALHL
LYMATGLSGEVIMPAMTYVATAHAARALGLTPVFCDVDPDTGCIDPRRAEEAVTARTSGI
VGVHLWGRPSAIDDLGKVAERHGLRLLFDAAHALGCSYRGRPVGGFGAAEVFSFHATKVV
NSFEGGAVVTDDGDLAERLRSLRSFGFGPDGTSQRVGINAKMSEAAAAMGLTSLEAFEET
RRHNRVNLDHYAAGLAGVDGVEVVTYDAAQNPNCQYVVIRVDEAVTGIHRDLLMRVLKEE
NITTQRYFSPACHQVEPYRTERPVVLPHTERLAEQVLALPTGPTVATADIHRVCEVLRCA
VGAGPQVTERFRGCEETA
NT seq 1137 nt   +upstreamnt  +downstreamnt
gtgggacggcccactgtcggtgacaggaagcgtttcctggagcggctgaacggggccctc
gaccggcaatggctgaccaacggcggccctttggtgcacgagttcgaggaccgcgtggcg
gaggtggccggcacccgccactgcgtggccaccagcaacgccaccatggcactgcatctg
ctgtacatggccaccgggttgtccggcgaggtcatcatgccggcgatgacctacgtggcc
accgcccacgcggcccgggcactcgggctcaccccggtgttctgcgacgtcgacccggac
accggctgcatcgacccgcgccgggcggaggaggccgtgaccgcgcgcacctccgggatc
gtcggggtgcatctgtggggcaggcccagtgcgatcgacgacctggggaaggtggcggaa
cggcacggtctgcgcctgctgttcgacgcggcccacgccctgggctgctcgtaccggggc
cggcccgtcggcggcttcggcgccgccgaggtgttcagcttccacgcgacgaaagtggtc
aacagcttcgagggaggcgccgtcgtcaccgacgacggtgacctcgccgaacggctgcgg
tccctgcgctccttcggcttcggccccgacggcaccagccagcgggtcggcatcaacgcc
aagatgagcgaggccgccgcggcgatggggctcacctcgctggaggcgttcgaggagacc
cggcggcacaaccgcgtcaacctcgaccactacgccgccggactggcgggagtggacggc
gtcgaagtcgtcacctacgacgccgcgcagaaccccaactgccagtacgtggtgatccgc
gtcgacgaggccgtcaccggaatccaccgcgatctgctgatgcgggtgctgaaggaggag
aacatcaccacccagcgctacttctcccccgcgtgccaccaggtcgagccgtaccgcacg
gagcgccccgttgtactcccgcacaccgaacggctcgcggagcaggtactggccctgccg
accggacccacggtcgcgacggcggacatccaccgggtgtgcgaggtcctacggtgcgcg
gtcggcgcggggccgcaggtgaccgagcggttccgaggctgtgaggagacggcatga

DBGET integrated database retrieval system