KEGG   Sphingobium yanoikuyae: A6768_22625Help
Entry
A6768_22625       CDS       T05170                                 

Gene name
ligD
Definition
(GenBank) DNA ligase D
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
sya  Sphingobium yanoikuyae
Pathway
sya03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:sya00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    A6768_22625 (ligD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sya03400]
    A6768_22625 (ligD)
Enzymes [BR:sya01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     A6768_22625 (ligD)
DNA repair and recombination proteins [BR:sya03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     A6768_22625 (ligD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C RNA_ligase DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: ATI82521
UniProt: A0A291N5H6
LinkDB All DBs
Position
4890002..4892515
Genome map
AA seq 837 aa AA seqDB search
MSRLHPLASYNAKRDFNRTSEPEGKMAKKGGNSFVVQKHAATRLHWDFRLEVDGVLKSWA
VTKGPSLDPDDKRLAVRTEDHPLSYGSFEGNIPKGEYGGGSVMLWDRGWWEPIPGKSAKD
IEDGHLHFILHGERMKGEWLLVRMKGRAGEKRENWLLRKIEDGEARRNGDLVERALTSVL
TDRSMAQIAGDIAGTQSLKGARGKTFTDRMQAANAHNAKIGRTKVKAIARTEAMPRFIKP
QLATLVDHVPVGNEWLHEIKYDGYRALVAVSGEAIKIYTRSGLDWTDKFGPLAAAIKALD
LPPALIDGEIIAFDADGNPSFSALQAVLKRGHGAERADTPFHFFAFDLLSLDGMDLKSLP
AIERKERLEALLADAEQPIHVADHLIGSGEKLYRSLCQAGQEGIIAKRVDAPYRSGRTRA
WVKVKCTRRQEFVIVGWTRSKVKGRAFSSLLLAQHEGGALVYKGKVGTGFDAATMTDLAE
AMSPIATGTSQIIISAAQARGVQWVKPKLVAEVGFAEFTREGLVRHGSFLGLRSDKLAKT
VKPEKAAPTPPSATAIRISNRARVIFPESGQTKGELADYYARIAPLMLPFAANRPISLVR
CPQGRAKKCFFQKHDSGAFGDHVRHVAIREKDGGSEDYLYVDDAEGLIACVQMGTIEFHG
WASRADAVEKPDRMIFDLDPDEGMDFARVREAAKDIRDHLRDIGLISFAMLSGGKGVHVV
VPLSPTHDWDAHKDFAARFAQALSAAEPDRFVATMSKAKRKDRIFIDWLRNQRGSTAILP
YSARARAGAPVAIPVDWDELNDLQDAHPYDIGDAEILGERAVKLKGWGFAAQTLPDL
NT seq 2514 nt NT seq  +upstreamnt  +downstreamnt
atgagccggctccatccccttgcctcctataatgccaaacgggacttcaatcgcaccagc
gagcctgaaggcaagatggcaaagaaaggcggtaacagtttcgttgtccagaaacatgcc
gccacaaggctgcactgggacttccggttggaagtcgatggcgtgctcaagagctgggcc
gtcaccaaggggccgagcctggatcccgatgacaagcggcttgctgtccgcaccgaagat
catcctctgagctatggcagtttcgagggtaatattcccaagggcgaatatggcggcggc
agtgtgatgctctgggaccgcggttggtgggaaccgatcccgggaaagagcgcgaaggat
atagaggatggccatctccatttcatcctgcatggcgaacggatgaagggggaatggctg
ctggtgcggatgaaggggcgcgcgggcgaaaagcgcgagaattggctgctccgcaagatt
gaggatggcgaagcccgccggaatggcgatctggtcgagcgcgcgctgacaagtgttctg
actgaccgctcgatggcgcaaatcgccggggacatcgccggcacgcagtcattgaaaggc
gccaggggcaagacattcacggataggatgcaggcggcaaacgcgcataatgcaaagatc
ggcaggacgaaggtgaaggcgatcgccagaacggaggctatgccgcgcttcatcaagccg
cagcttgcaactttggtcgaccatgtaccggtcggcaacgaatggctgcacgagatcaaa
tatgacggatatcgcgcgctcgttgcagtcagtggcgaagcgataaaaatatatacgcgc
agcggcctggactggacggacaaatttggtcctttggctgcagccataaaagcgctcgac
ctcccgcctgcattgatcgacggcgagatcatcgcctttgacgctgacggcaatcccagt
ttttcggcgctgcaggcggtgttgaaacggggccatggcgcggagcgagccgacacgccg
ttccatttcttcgcttttgatcttctttcacttgacggcatggatttgaagtctctcccc
gcaatcgagcgaaaggagcggctcgaagccttattggcggatgcagaacaaccgatccac
gttgccgatcacctgatcggctcgggcgagaagctctaccgatcgctttgtcaggccggg
caggaaggcattatcgcaaagcgcgtcgatgcgccctatcgcagcggacggacacgcgcc
tgggtgaaggtcaaatgcactcgtcggcaggaattcgtgatcgtcggctggacccgtagc
aaggtaaaagggcgtgccttctcctccctgctactggcgcagcatgaaggcggtgcactg
gtctataagggcaaggtcggcactggtttcgatgccgccacaatgaccgacctggccgag
gccatgagtccgattgcgaccggcacgtcgcagatcatcatttccgccgcccaagcgcgc
ggcgtccaatgggtcaaacccaagctcgttgcggaagtcggttttgccgagttcacaagg
gagggtctcgtgcgacatggcagttttctggggctacgaagcgacaagttggcaaagacg
gtcaagcccgaaaaagcggccccaacgcctccttcggccacagccatcaggatcagcaat
cgcgcgcgcgtgattttcccggagagcgggcagaccaaaggggagttggccgattattac
gcgcggatcgccccgctgatgctacctttcgccgccaatcggccgatcagtcttgtgcga
tgcccccagggccgcgcgaagaaatgctttttccaaaaacatgacagcggcgcctttggc
gaccatgtccgccatgttgcgatccgcgagaaagacggcggctcggaagattatctctat
gtcgacgatgccgaaggcctgatcgcttgcgtccagatgggtacgattgaatttcatggc
tgggcgagccgtgccgatgccgtcgagaagcccgatcgcatgatcttcgatcttgatccc
gacgagggcatggattttgcacgggtgcgtgaagcggcaaaggatattcgcgatcatctg
cgcgacatcggtctgatctccttcgccatgctgtcgggagggaagggggtccatgtcgtc
gtccccctcagccccacccacgactgggacgcacataaggatttcgctgcccgtttcgcc
caggccttgagcgcggcagaacccgatcgctttgttgccacgatgagcaaggccaagcgc
aaggatcgcatattcatcgactggctgcgcaatcagcgcggcagcaccgccatccttccc
tactcggcgcgcgcgcgtgccggcgcgcctgtagccataccggtcgactgggacgaattg
aacgatttgcaggacgcccatccctacgacattggagatgccgaaatattgggggagcgc
gcagtgaagctcaaaggctggggcttcgctgcgcagaccctgcccgatctatga

DBGET integrated database retrieval system