KEGG   Synechocystis sp. PCC 6803 PCC-N: SYNPCCN_0488Help
Entry
SYNPCCN_0488      CDS       T01778                                 

Gene name
gad
Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
sys  Synechocystis sp. PCC 6803 PCC-N
Pathway
sys00250  Alanine, aspartate and glutamate metabolism
sys00410  beta-Alanine metabolism
sys00430  Taurine and hypotaurine metabolism
sys00650  Butanoate metabolism
sys01100  Metabolic pathways
sys01110  Biosynthesis of secondary metabolites
sys01120  Microbial metabolism in diverse environments
sys02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:sys00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    SYNPCCN_0488 (gad)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SYNPCCN_0488 (gad)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SYNPCCN_0488 (gad)
   00430 Taurine and hypotaurine metabolism
    SYNPCCN_0488 (gad)
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    SYNPCCN_0488 (gad)
Enzymes [BR:sys01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     SYNPCCN_0488 (gad)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: BAL31405
LinkDB All DBs
Position
complement(543558..544961)
Genome map
AA seq 467 aa AA seqDB search
MVHKKIDLNQLSEAESLLTPTYAARGLANSVSKYEMPETEMLPAIAYNLIHDELGLDGNS
RLNLATFVTTWMEPEARQLMADTFDKNMIDKDEYPQTAEIELRCVNILSRLWNAPASAEA
TGCSTIGSSEAAMLGGMAMKWKWRQRRQAAGKPGDRPNLVMGINVQVCWEKFCRYWEVEP
RFVPMEGDRYHISPEEAVKLIDENTIGVIGILGSTFDGSYEPIEALNDALETLNQRTGWQ
VPLHIDAASGGFIAPFLDPDLRWDFRLPWVKSINTSGHKYGLVYPGVGWIIWRDKEELPE
ELIFHCNYLGGDLPNFALNFSRPGNQVVAQYYNFLRLGKEGYRKIQQTCRDTALYLSGKI
AQLGPFELLTDGGDIPVFAWRLKDEVLANTCYTLYDMADKLRERGWLVPAYRMPKNREDL
VVQRIVVKEGFSRDMADLLLADMERAIAYFASQPDHKPKQEGSHFSH
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggtgcataaaaaaattgacctcaaccagctcagtgaagcggaaagcctactgaccccc
acctatgcggcccggggcctagccaattctgtcagtaaatatgaaatgccagaaacggaa
atgctaccggcgatcgcctataacctcatccacgatgaactggggctagatggcaattcc
cgattaaacctggccacctttgtcaccacttggatggagccggaagctaggcaactgatg
gcggataccttcgacaaaaacatgatcgataaggatgaatatccccaaacggcggaaatt
gagttgcgttgcgtcaatattttgtcccgactctggaatgctccggccagtgcggaagcc
accggctgttccaccattggttctagtgaagcggccatgttgggggggatggccatgaag
tggaaatggcggcaacgacgacaagcggcagggaaaccaggcgatcgcccgaatttggtt
atgggcattaacgtccaggtttgttgggaaaagttttgtcgttactgggaagtggaaccc
cgctttgtccccatggaaggcgatcggtaccacatcagcccggaagaagcagttaagcta
attgacgaaaataccatcggtgtaattggtattttaggtagcacctttgacggcagttat
gaacccattgaagcgttgaacgatgccctggaaactttaaatcaaagaactggttggcag
gtgcctctgcacatagatgccgccagcggtggttttattgctccctttttagatccagat
ttgcgttgggattttcgtttaccttgggtgaaatccatcaacacctctggccacaaatac
ggtttagtttatccgggggtaggttggatcatttggcgggataaggaagaattaccggaa
gaattaattttccattgcaactatttggggggagatttacccaactttgccctcaacttt
tcccgccccggcaatcaggtagtggcccagtattataactttctccgcttaggcaaagaa
ggttaccgcaaaatccaacagacttgtcgagatacggctctgtatctatctggcaaaatt
gcccaattaggcccttttgaattgctcaccgacggtggggatatcccggtttttgcctgg
agattaaaggacgaagtattggccaacacttgttataccctgtacgacatggccgacaaa
ttgcgggaacggggctggttggtgcccgcctatcgcatgcccaaaaaccgtgaagatttg
gtggtgcaacgcattgtcgtgaaagagggttttagtcgggatatggcggaccttttgtta
gcggacatggaaagggcgatcgcctattttgccagccaaccggaccacaaaccgaagcag
gaaggttcccactttagccattag

DBGET integrated database retrieval system