KEGG   Trichoplax adhaerens: TRIADDRAFT_58375
Entry
TRIADDRAFT_58375  CDS       T01069                                 

Definition
(RefSeq) hypothetical protein
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
tad  Trichoplax adhaerens
Pathway
tad00230  Purine metabolism
tad01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tad00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    TRIADDRAFT_58375
Enzymes [BR:tad01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     TRIADDRAFT_58375
SSDB
Motif
Pfam: Guanylate_cyc AC_N
Other DBs
NCBI-GeneID: 6755392
NCBI-ProteinID: XP_002114494
JGI: 58375
UniProt: B3S1X8
LinkDB
AA seq 806 aa
MTTSDKLTANIVLIIGSNVIGLIIFSVSDQKQRLAFLDTRMSMEAKVKMEAQSKQQERLL
TSVLPRYIAMEIQGNMNSSSKVGMTEKQFSHFYIQRYENISILFADIVGFTKLSSTFTAQ
QLVQTLNELFGSFDEKAEENHCLRIKILGDCYYCICGVPDPRPDHAQLTVEMGVAMIRVI
ADVRKKTGVSSLDMRVGIHSGAGLCGVMGRRKWQFDVWSSDVTLANNMEAGGIPGRIHIT
DTTYKHLKDDYEVEDGNGGSRSEYLRQRNIHTYLIKRRKHTRNKQCNTENLKLDGSSSKS
GNGSNAHHTEEIDYEDKLTKMLDEDLQNRDLDNGEISNPLTLRFKVTETERNYNCEKENM
GFTLLIACYIVQVTCFIVSAIILPITLTRTILFAIGSAINIFLVIVTAASNYRKKFYRWL
VNLSVYIENRKILSALLAALPAVIIFIAELTEIIQCNTVAVEFNNANNCYFNNSQFYTQN
HICKHPVYTMYNMIMLLMVVSALIQLSYEFKLVLLTLITAASIIVVMIPVQNAFTCYDTI
VYNSSYGLYADYIQINYLSTFNIGVALIVLVCSTRQMEITARILFLWKKEAIEKKDGVEE
LQRRNELLVQNILPLHVAKHFLTRQGEIYNESHNEIGVMFASIPNFQDFYSEDEINVQGK
ECLRFLNEVIIDFDNENVDKWQHLVDLADFALDLIKKLKEINENSFNSFHLRIGISSGPI
VAGVIGVNKPHYDIWGNTVNVASRMDTTGKPGSVQVFQETQEILATRGFKFTCRGLIPVK
GKGKLLTYYLLGREATGANHLPNMLH
NT seq 2421 nt   +upstreamnt  +downstreamnt
atgaccacatcagataaacttacggccaacatcgtcctcatcatcggatccaatgtcatt
ggcctcattatctttagtgtatcagatcagaaacaacgtcttgccttcttagatacacga
atgtctatggaagctaaagttaaaatggaagcacagtcaaaacagcaggagcgtctttta
acatctgtattaccgcgttacatcgctatggaaatacaagggaatatgaattcatcttca
aaagttggtatgacagagaaacagtttagccacttttatattcaacgctacgaaaatata
agtatactatttgctgatattgttggctttacgaaattgtcctcaactttcaccgctcaa
caattagtacagacactcaatgaattattcggtagttttgatgaaaaagctgaggaaaat
cactgcctgcggattaaaattttgggcgattgttattactgcatttgtggcgtacccgat
ccacgaccagatcatgcacaactaacagttgaaatgggagtagctatgattcgtgttata
gcagatgtaagaaagaaaactggtgtatcatcgttagatatgagagttggaattcattct
ggtgccggattatgcggtgttatgggtagaagaaagtggcaattcgacgtctggtcttct
gatgtaacattagctaataatatggaagctgggggtattccagggcgtattcacataacg
gatactacttacaaacatttaaaagatgattacgaagttgaggatggcaatggaggtagt
agaagtgaatatctccgccaaaggaatattcatacctatttaattaagagaagaaagcat
acaagaaataagcaatgtaatacagaaaatttaaagttagatggaagttccagtaaaagt
ggcaatggctctaacgctcaccatacagaagagatagattatgaagacaagctaactaag
atgttggatgaagacttacagaatcgagatctggataatggagaaatttcgaatccgtta
acattacgatttaaagtcacagaaaccgaaaggaactataactgtgaaaaagaaaatatg
ggtttcactttattaattgcttgttatatcgtacaagtaacctgttttattgttagcgct
attatcctaccaataacgctaacaagaacaattctttttgctattggctctgcaataaac
atatttttggttatagttactgccgcgtcaaattatcgaaagaaattttatcgatggttg
gttaacttatcggtatatattgaaaatcgtaaaatcctatcggcactccttgctgcttta
ccagcagttattatatttatagccgaactgacagaaatcattcaatgtaatacggtagct
gtcgaatttaacaacgccaataactgctattttaacaatagccaattttacacacaaaat
catatttgcaagcatcctgtttatacgatgtacaacatgattatgctgttgatggtggtt
tcagcgctaattcaactaagctatgaatttaaactagtccttttgacgctcattactgcc
gcttcaattattgttgttatgatacccgttcagaacgcttttacatgctacgacactatc
gtttataattctagttatgggttatatgctgattatatacaaatcaattatttatcaaca
tttaatattggagttgccttgatcgttttagtatgtagtacaagacagatggaaattaca
gctcgaatattgtttctatggaaaaaagaggccatagaaaagaaagatggagtcgaagaa
ttacagcgtcgtaacgagctattggttcaaaatattttgccacttcatgtagctaaacat
ttcttaacccgtcaaggagagatttataatgaatcccataacgaaatcggcgttatgttt
gcgtccatacctaattttcaagatttctattctgaagatgaaattaacgtacaaggaaag
gaatgtctccgtttcttaaatgaagtgattatcgattttgataacgaaaatgtagacaag
tggcaacatcttgttgatttggccgattttgcgcttgatttgattaaaaaattaaaagaa
ataaacgaaaattctttcaatagctttcacttaagaattggaatatcatctggccctata
gtagctggtgttattggtgtaaataagccacattatgatatatggggaaatactgttaat
gttgctagtaggatggacacaactggaaaacctggctctgttcaagtttttcaagaaact
caagaaattttagctactagaggatttaaatttacttgcagaggattgatacctgtcaaa
ggcaaaggaaagttattaacttactatttgcttggaagggaagcgactggtgcaaatcat
ttaccgaatatgctccattag

DBGET integrated database retrieval system