KEGG   Thermosipho africanus: THA_1495Help
Entry
THA_1495          CDS       T00797                                 

Definition
(GenBank) L-threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
taf  Thermosipho africanus
Pathway
taf00260  Glycine, serine and threonine metabolism
taf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:taf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    THA_1495
Enzymes [BR:taf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     THA_1495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 AdoHcyase_NAD 2-Hacid_dh_C NAD_binding_7 Met_10 ADH_N_2
Motif
Other DBs
NCBI-ProteinID: ACJ75936
UniProt: B7ID59
LinkDB All DBs
Position
complement(1505315..1506346)
Genome map
AA seq 343 aa AA seqDB search
MKAILKETAGPGFVMKEVPKPEKLGPREVLVKIRRASICGTDVHIYKWDEWSQSRINPPL
IVGHEMAGEVVAIGEAVTQVKVGDLVSAETHIPCEHCVQCKTGRMHVCKNLEILGVDRNG
VFTEYAIIPETVLWRFSKEIPLDYASVMEPFGNAIHTALVTDLTGKKVLITGAGPIGLMA
IQVAKASGASLVITSEVDPNRIQMAKENGADIVINPAEQDLVKSIYTITDDGVDILLEMS
GNKKALEDGLKCVTMGGEASLLGIFGGSIDINLDSLVIMRGITIYGITGRKMFDTWKVAD
ELLRSKKVDLSKVVTHVLPFEDWEKGFELMLNKQCGKVVLNLD
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccattttaaaagaaacagcaggtcctggttttgtaatgaaagaagttccaaag
cctgaaaaattaggcccaagagaagttttagtgaaaattaggcgtgcttctatatgtgga
actgatgtccatatatacaaatgggatgaatggtctcaatcaagaataaatccaccacta
atagttggtcacgaaatggcaggtgaagttgttgcaattggtgaagctgtaactcaagta
aaggttggagatctagtatctgcagaaacacacattccttgcgagcattgtgtgcaatgt
aaaactggaagaatgcatgtatgtaaaaacctagaaattttaggtgttgatagaaatggg
gtttttacagaatatgcgatcattcccgaaacagtactctggagattttcaaaagaaatt
ccattagattatgcatcggttatggaaccattcgggaatgcaattcatacagcccttgta
acagatcttacaggaaaaaaagttttgattaccggtgctggaccaataggtttaatggca
atacaggtagcaaaggcatcaggtgcaagtcttgttataaccagtgaagttgatccaaat
agaattcaaatggcaaaggaaaacggtgcagatattgtaattaatccagcagagcaagat
ttagtaaaaagtatatatacaataacagatgatggagtagacatattacttgaaatgagc
ggaaataaaaaggctttagaggatggattaaaatgtgtaacgatgggaggagaagcttca
ttacttggaatttttggtggtagcatcgatatcaatctagattctcttgtcataatgaga
ggaatcactatttatggaatcacaggaagaaaaatgtttgatacatggaaggttgcagat
gagcttttaagaagtaaaaaggttgacctttcaaaagttgttactcatgttcttccattt
gaagattgggaaaaaggctttgaattaatgttaaacaaacaatgtggaaaagttgtttta
aatcttgattag

DBGET integrated database retrieval system