KEGG   Thauera aromatica: Tharo_0567Help
Entry
Tharo_0567        CDS       T05381                                 

Definition
(GenBank) Alkyl hydroperoxide reductase AhpF
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
tak  Thauera aromatica
Brite
KEGG Orthology (KO) [BR:tak00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Tharo_0567
Enzymes [BR:tak01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Tharo_0567
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 HI0933_like Thioredoxin_3 DAO FAD_oxidored NAD_binding_8 AlaDh_PNT_C FAD_binding_3 Thi4 FMO-like K_oxygenase
Motif
Other DBs
NCBI-ProteinID: AVR87510
UniProt: A0A2R4BJK0
LinkDB All DBs
Position
577359..578927
Genome map
AA seq 522 aa AA seqDB search
MLDANIKTQLKAYLDKVTQPIEIAASLDEGDKSGEMRTLLAELAELSDKITVVESGAPGV
QASERKPSFALARPGEPGRVRFAGLPMGHEFSSLILALLQVGGHPPKATPELIEQIRALD
GEYVFETYISLSCHNCPEVVQALNLMAVLNPNIRHTMIDGALFQGEVEARKIMAVPTVLL
NGQPFGQGRMELGEILAKVDTGAAARDAGKLSAKDVFDVLVVGGGPAGAAAAIYAARKGI
RTGVVAERFGGQVMDTMAIENFISVKYTEGPKLVASLEEHVREYDVDVMNLQRVAQLLPG
AGVHEVKLDNGAVLKAKSVIVATGARWREMNVPGEREFRGKGVAYCPHCDGPLFKGKRVA
VIGGGNSGVEAAIDLAGVVAHVTLLEFADELRADAVLQKKLHSLPNVTVIKGAQTTEVTG
SDKVDGLVYKDRASGEVRRIELEGIFVQIGLLPNTDFAKGTLELTRFGEIIVDAKGQTSV
PGIFAAGDCTTVPYKQIIIAMGEGAKASLSAFDHLIRSSAPA
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgccaacatcaagactcaactcaaagcctacctggacaaggtcacgcagccg
atcgagatcgccgcgtcgctggacgagggcgacaagtcgggtgaaatgcggaccctgctc
gccgaactcgccgagctcagcgacaagatcaccgtcgtcgagtcgggtgcgcccggcgtt
caggcgagcgagcgcaagccctcgtttgcgcttgcccgcccgggcgagccggggcgcgtg
cgttttgccgggttgccgatggggcacgagttcagctcgctgatcctggccctgctgcag
gtcggcggccatccgcccaaggccacgcccgagctgatcgaacagatccgcgccctcgac
ggcgagtacgtgttcgagacctacatctcgctgtcctgccacaactgcccggaagtggtg
caggcgctgaacctgatggcggtgctcaaccccaacatccgccacaccatgatcgacggt
gcgctgttccagggcgaagtcgaggcgcgcaagatcatggcggtgccgacggttctcctc
aacggccagcccttcggccaggggcggatggagctgggcgagatcctggccaaggtcgac
accggcgccgcggcgcgcgatgccgggaagctgtcggccaaggacgtcttcgacgtgctc
gtcgtcggcggcggcccggccggcgcggccgccgcgatctacgccgcgcgcaagggcatc
cgcaccggtgtcgtcgccgagcgcttcggcggccaggtgatggacacgatggcgatcgag
aacttcatctcggtgaagtacaccgagggcccgaagctggtcgccagcctcgaggagcac
gtccgcgaatacgacgtcgatgtcatgaacctgcagcgcgtcgcgcagctgctgccgggc
gcgggcgtgcatgaagtgaagctcgacaacggcgccgtgctcaaggcgaagtccgtcatc
gtcgccaccggcgcgcgctggcgcgagatgaacgtgcccggcgagcgggagttccgcggc
aagggtgtggcctactgcccgcactgcgacggcccgctgttcaagggcaagcgcgtggcg
gtgatcggtggcggcaactccggcgtcgaggccgcgatcgacctcgccggggtggtcgcc
cacgtcaccctgctcgagttcgccgacgaactgcgtgccgacgccgtgttgcagaagaag
ctccacagcctgcccaacgtgacggtgatcaagggcgcgcagaccaccgaagtgaccggt
agcgacaaggtggacggtctggtgtacaaggaccgagccagtggcgaagtgcgccgtatc
gagctcgaaggcatcttcgtccagatcggcctgctgcccaataccgacttcgccaagggc
acgctcgagctcacccgcttcggcgagatcatcgtcgatgccaaaggccagacttcggtg
ccgggcatcttcgccgccggcgactgcaccacggtgccgtacaagcagatcatcatcgcc
atgggcgaaggggcgaaggcttcgctgtcggccttcgatcacctgatccggagcagcgcc
ccggcctga

DBGET integrated database retrieval system