KEGG   Thauera aromatica: Tharo_3323Help
Entry
Tharo_3323        CDS       T05381                                 

Definition
(GenBank) Quinohemoprotein alcohol dehydrogenase QdgA
  KO
K17760  quinohemoprotein ethanol dehydrogenase [EC:1.1.9.1]
Organism
tak  Thauera aromatica
Brite
KEGG Orthology (KO) [BR:tak00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Tharo_3323
Enzymes [BR:tak01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.9  With a copper protein as acceptor
    1.1.9.1  alcohol dehydrogenase (azurin)
     Tharo_3323
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PQQ_2 PQQ PQQ_3 Cytochrome_CBB3 Cytochrom_C
Motif
Other DBs
NCBI-ProteinID: AVR90204
UniProt: A0A2R4BSM8
LinkDB All DBs
Position
complement(3570226..3572343)
Genome map
AA seq 705 aa AA seqDB search
MKLPSRLHLAGACLIFPLAFGASAASAPAAVDAARIIAADREPGNWMSHGRTYDEQRYSP
LKRITDRNVGELGLAWTARLDIDRGVEATPIVVDGVMYTTGAKSIVYAFDARSGTLLWKF
DPDVPGIRMSEGCCDVVNRGVAVWQGKVYVGAYDGRLIALDARDGRKLWETDTVVDHARS
YTITGAPRVVKGKVLIGNGGAEYGVRGYVSAYDADTGKLAWRFYTVPGDPAQEKDDRAMD
IARKTWHGTEYWKQGGGGTVWDSMAYDPELDLLYIGTGNASWWNRQARSEGKGDNLFVSS
IVALRPDSGEYVWHYQTTPGDMWDYTATQHIILAELPIDGKKRKVLMQAPKNGFFYVLDR
TNGKLLSAEKFAPVNWATHVDLATGRPAVDEEAANYLKGPKVISPAFIGAHNWHPMSFNP
ATGLVYIPMQETAGMLSAPANPERVAHKSVVNLGVDVPDLPEDPEVVKQIAASFKGKLLA
WDPVQQQAVWTQDYRTIYNGGTLSTAGNLVFQGTADGRVTAYAADSGKLLWSSPANTGVM
AGPVTYEVDGEQYVTFMAGWGGIFPLILGPLSREARVQPEARVLTYKLGGKVVLPPPAQL
PQAVPQPPAVTASAEDLAAGRTLYNGFCGGCHGLNAISGGVLPDLRYLDARKHAQFKDIV
LMGARAAKGMPPFAGTVSEADAERIHQYLIKRAHDLRQEAASARP
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgccgtcacgcctgcacctcgctggtgcctgtctgatctttccgctggctttt
ggcgccagcgccgccagtgccccggcggcagtcgatgctgcacgcatcatcgcggccgac
cgcgagccgggtaactggatgagccacggccgcacctacgacgagcaacgctactcgcca
ctcaagcgtatcaccgaccgcaatgtcggtgagctcggcctggcatggaccgccaggctc
gacattgaccgcggggtggaggcaacgccgatcgtggttgacggtgtgatgtacaccacc
ggtgcgaagagtatcgtctatgccttcgatgcacgctccggcacgctgctgtggaagttc
gatcccgatgtgcctggtatccgtatgtccgaaggctgttgcgatgtcgtcaatcgcggc
gttgcagtgtggcagggcaaggtctacgtcggtgcctacgacggccggctgattgcactc
gatgcacgcgacggacgcaagctatgggagaccgacacagtggtcgaccacgcccgtagt
tacaccatcacgggtgcgccacgggtagtcaaggggaaggtgctgatcggtaacggtggt
gcggagtatggcgtgcgcggttatgtatctgcctacgatgcggacaccggcaagctggcc
tggcgcttctacaccgtgcccggcgatccggcgcaagagaaagacgaccgtgcgatggat
atcgcccgtaagacctggcacggtacggagtactggaagcaggggggcggaggtacggtg
tgggattcgatggcttacgaccccgaactcgacctgctttacattggtaccggcaatgcg
tcgtggtggaaccgccaggcccgctccgaaggcaagggcgacaacctgttcgtatcgtca
attgtcgcactgcgccccgacagcggtgagtacgtgtggcactaccagaccacgccgggt
gacatgtgggactataccgccacccagcacatcatcctggccgagctgccgatcgacggc
aagaagcgcaaggtgctgatgcaggcgccgaagaacggcttcttctacgtgcttgaccgg
accaacggcaagctactgtcggcggagaagttcgcgccggtcaattgggccacccatgtc
gatcttgccaccggacggcctgcggtggacgaggaggctgcgaactacctgaaggggccg
aaggtgatctcgccggccttcatcggcgcgcataactggcacccgatgtccttcaatcct
gccaccgggttggtctacatcccgatgcaagagaccgccggcatgctgtcggcgcccgcc
aatccggagcgggttgcccacaagtcggtggtcaacctcggggtggatgtgcccgacctg
ccggaggaccccgaggtggtcaagcagattgccgccagcttcaagggcaagctgctggcc
tgggatccggtccagcagcaggcggtgtggacgcaggactatcgcaccatctacaacggc
ggtacgttgagcacggcgggcaatctggtattccagggtacggccgatggtcgcgtgact
gcgtatgcggcggacagtggcaagctgttgtggtcgtctccggccaataccggggtgatg
gccgggccggtcacctatgaggtcgatggcgagcagtacgtgaccttcatggcgggctgg
ggcggtatctttccgctgatcctcgggccgctgtcgcgtgaggccagggtgcagcccgaa
gcccgggtgctgacctacaagctgggtggcaaagtcgtgctgccgccgccggcgcagctg
ccgcaagcggtaccgcaacccccggccgtgacggccagcgccgaggacctggcggccggc
cgcacgctgtacaacggcttctgcggcggttgccatggtttgaatgcgatttccggcgga
gtgctgcctgacctgcgctatctcgatgcgcgcaagcacgcccagttcaaggacatcgta
ctgatgggcgcgcgcgccgccaagggcatgccgccttttgccggtacggtctccgaggcc
gatgccgaacgcatccaccagtacctgatcaagcgtgcgcacgacctgcggcaagaggct
gccagcgcccgcccctga

DBGET integrated database retrieval system