KEGG   Thermoplasmatales archaeon BRNA1: TALC_01089
Entry
TALC_01089        CDS       T02532                                 

Definition
(GenBank) hypothetical protein
  KO
K16182  3-methylornithyl-N6-L-lysine dehydrogenase [EC:1.4.1.-]
Organism
tar  Thermoplasmatales archaeon BRNA1
Pathway
tar00300  Lysine biosynthesis
tar01100  Metabolic pathways
tar01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tar00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    TALC_01089
Enzymes [BR:tar01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.-  
     TALC_01089
SSDB
Motif
Pfam: 2-Hacid_dh_C THF_DHG_CYH_C AdoHcyase_NAD AlaDh_PNT_C NAD_binding_7 Mrr_cat IlvN NAD_binding_2 Sacchrp_dh_NADP TrkA_N Shikimate_DH ADH_zinc_N ELFV_dehydrog 3HCDH_N
Other DBs
NCBI-ProteinID: AGI48079
UniProt: M4YLM0
LinkDB
Position
complement(988657..989493)
AA seq 278 aa
MTRLTPAMIDGLSDELSALDKYLIGATGMDIRTLGFRAIGVDPTKVDITKYKAASVPITS
GLGVIGGFSKSVADIVRDMGMECFVTERTDVWGFGEAIDRGADIILMADDEQYMAYSVAA
GKYSNNSYCTAAGYVEALRGAADGLEGKDVFVRGAGRVGSNMVALLRAAGARVTVGDVIK
EKAEAVAKANPGTCVADDIDEATYAAHLLLNASPSPIPGQYVREGAIISTPGIPHVYDEE
TLKKAKFIHDPLAIGTAPMVAQAIAFSLPEDCFLRKEE
NT seq 837 nt   +upstreamnt  +downstreamnt
atgaccaggctcacccccgctatgatcgacgggctctccgacgagctcagcgccctggac
aagtatctcatcggcgccacaggcatggacatccgcaccctggggttccgcgccataggt
gtggatccgaccaaggtggatatcacgaaatacaaggccgcgtctgttccgatcacctcg
ggtctcggggtcatcggaggattctcgaagagtgtggcggacatcgtccgcgacatgggc
atggagtgcttcgtaaccgagcgtacggatgtctggggattcggcgaggccatcgaccgc
ggggccgacatcatactcatggccgacgacgagcagtacatggcgtacagcgtcgccgcc
gggaaatactccaacaactcgtactgcaccgcggcaggatacgtggaggccctcaggggc
gccgcggacggcctggagggcaaggacgtgttcgtcagaggagcgggaagggtgggcagc
aacatggtcgcccttctccgcgccgcaggcgcaagggtgaccgtcggagacgtcatcaag
gagaaggcggaagcagtcgcaaaagccaatcctggcacatgtgtcgcagacgatatcgac
gaggccacatacgcggcccatctcctgttgaatgcatccccgtcgcccatcccgggacag
tacgtgagggagggagcaatcatctccacgccgggtatcccccacgtgtacgatgaggag
actctgaagaaagccaagttcatacacgatccgcttgccataggcacagcgcccatggtc
gcgcaggcaatcgcattcagcctgcccgaggattgtttcttaaggaaagaggaatga

DBGET integrated database retrieval system