KEGG   Thiolapillus brandeum: TBH_C0778
Entry
TBH_C0778         CDS       T03600                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K20370  phosphoenolpyruvate carboxykinase (diphosphate) [EC:4.1.1.38]
Organism
tbn  Thiolapillus brandeum
Pathway
tbn00620  Pyruvate metabolism
tbn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tbn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    TBH_C0778
Enzymes [BR:tbn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.38  phosphoenolpyruvate carboxykinase (diphosphate)
     TBH_C0778
SSDB
Other DBs
NCBI-ProteinID: BAO43715
LinkDB
Position
complement(844430..847930)
AA seq 1166 aa
MDLQRALGLDTPDTSAKKERKKLHMYINLKLASSGQPTCADGYATAFLSTADDLLRTYRE
KNRLLTDYRCPVDRRIENYLQDYLGDLDMDLPRLPSTTFVLDRHGVARELSLPMGKDEFK
SDIVSSYRVRQGVLHNPASDRRTTKGSFHIAEGGLPIPGDKKAVPRDVFAALLSRALTPP
DSLLTIPFTADEETPARMFVSLLLRPVVCPEIPGMDAEKTMEIRFFAPGNLVSNLDFVES
IFGNGGNPYLPKFDSALDVEHWTGHTGCVILAPHLVNFTKKELGLPRWEEASERQRREGM
CWKDEGELYNDGQAFKITARDERGVIVTILADNYYGYCKKEVKTQIGYSANLFGLAEEEH
AGGALAFPRRNHGEEFGVDSRTRDPNYSFEEMIENYGPLMKVKSKGYAIDRKFPDVIYVP
QDLRMNLNKQTISWWKDGKKQQIRLQPGKIYVQPNGYKIEMKKHPGAPSWRLVGMDPEGT
FCHKPSTVSGGGKSEISKSLNDAVIYSPLFVDELQADLDRVQEIFDRDYSTRFKSGHENE
DRDPSRKPLSEERSLGSVIKLLTPSSSYTDEYNEWLESIPPRILALVLMIKRFYRQEWGQ
QWRQHLTVDVVDGAPGHELKLHDRKVIASYLRVGFDRANKWRVFKVRQDFIAAEKVQMED
DISASVVVPVKAISHCSPGDEHSHSVKLVKNCEYRLFQRPDDAVIPGYDKQTEKDMSQPG
NFLANYEPLTGKALAAVVEDVMTLCSFTPPMRKLLESAYKKGKGYVVSSAHPRLVDGKPS
KNPRYLQTRPDLINPMRKYVAEMGARLHRKLPLGEPVCQPVDAVLAGRRNNPPEPGIRPL
AVYNPIHYQELPELFMDFICSLTGKSPSTTGAGSEGALTKGPFNALRPTADLNNALVSFI
LTGYAGYSSSAGFIGPDLRVDHDISLLIPEIWARLHPSQRDPKNLIEHGYLEPLHDFEHK
GEKVLASRLGYRITDRFVHGFLGKIFDNPNQVFTDEILKPETQNMDIFADGVGNIVEAQR
KVAQRYLDDGSIDEACPPLRALLYIMATGEYEGKDAHHPEIRAMFTRESLLASDWYHERL
EVKQQRDVTLWEGHIAALESFLAQPGYEDEARRLNIAQRLESARARLARTRSPDYLESLV
GTIGADPLRPSATAGAATAREEKQVA
NT seq 3501 nt   +upstreamnt  +downstreamnt
atggatctccaaagggctctcggtctggatacaccagacaccagcgcaaaaaaagaacga
aaaaagctccacatgtacatcaatctcaagctggcctcttccggccagccgacctgtgct
gatggctatgccacagcctttctctccaccgctgatgacttgttgcgcacctaccgggag
aagaatcggttgctcacggactaccggtgtcccgtagaccggcgtatcgagaattacctg
caggattatctgggtgacctggatatggatctcccccgcctgcccagcaccacttttgta
ttggaccggcatggcgtcgcccgggaattgtctctgcccatggggaaagacgaattcaaa
tccgatatcgtgtccagctaccgggtcaggcagggcgtcttgcacaacccggccagcgac
cggcgcaccaccaagggttctttccacattgccgaggggggattgccgattccaggggac
aagaaagccgttcccagggacgtatttgccgccttactcagccgcgccctgacgccaccg
gattccctgctcaccatccccttcacagccgatgaagaaacgccggcgcgcatgttcgtc
tccctgctgttgcgtccggtagtgtgtccggagattcccggaatggatgcggagaagacc
atggaaatccgcttcttcgctccgggcaacctggtgagcaacctggacttcgtggaaagc
atcttcggcaacggaggcaatccttatttgcccaagttcgactccgccctggacgtggaa
cactggaccggccacacgggctgcgtgatcctggccccgcatctggtgaacttcacgaag
aaggaactgggcctgccccggtgggaagaagccagtgaacggcaacgcagggaaggcatg
tgctggaaagacgaaggggaattgtacaatgacggccaggccttcaagatcacggcccgg
gacgagcgcggcgttatcgtcaccattcttgccgacaactattatggttactgcaagaag
gaagtgaaaacccagatcggctattccgccaacctgtttggtctggccgaggaagagcat
gccgggggcgccctggccttcccgcgccgcaaccacggcgaggaattcggcgtggacagc
cgcacccgcgatcccaactacagcttcgaggaaatgatcgaaaactatggccccctgatg
aaggtgaaatccaagggttacgccatcgaccgcaagttccctgacgtgatctatgtgcct
caggacctgcgcatgaacctcaacaagcaaaccatcagctggtggaaagacggcaagaaa
cagcagatccgtctgcaaccgggcaagatctacgttcagcccaacggctacaagatcgag
atgaagaagcatcccggcgcaccctcctggcgactggtgggcatggatcccgaagggact
ttctgccataaacccagcacggtttccggcggcggaaagtccgagatatccaagtctctg
aacgatgcagtgatttattcccctctgttcgttgacgaacttcaggcggacctggaccgg
gttcaggaaatcttcgacagggactacagcacccgcttcaaatccggccacgaaaatgaa
gatcgtgatccctcgcgcaaacccctgagcgaagaacgcagccttggctcagtgatcaag
ctccttaccccctcatccagctacacggatgaatacaatgaatggctggaatccattccg
ccacgcatcctggccctggtactcatgatcaagcgtttctatcgccaggaatggggacaa
cagtggcgccagcatctcaccgtggacgtggtggatggtgctcccggccatgaactcaaa
ctgcacgaccgcaaagtcatcgcctcctacctgcgggtgggcttcgaccgcgccaacaag
tggcgggtattcaaggtgcgccaggatttcatcgccgcagaaaaggtgcagatggaggac
gatatcagcgcttccgtggtggtacccgtcaaggccatcagccactgcagccccggtgac
gagcattcccacagcgtaaagctggtgaagaactgcgaataccgcctgttccagcgtccg
gatgacgccgtcatccccggctatgacaagcagacggaaaaggacatgtcccagcccggc
aacttcctggccaactacgagcctctcacgggcaaggccctggccgccgtggtggaagac
gtgatgaccctgtgcagtttcaccccgcccatgcgcaagctgctggaatctgcttacaag
aagggcaagggctacgtggtgtcttccgcccatccccgcctggtggatggcaagccctcc
aaaaatccccgctatcttcagacccgtccggacctgatcaaccccatgcgcaaatacgtg
gccgagatgggcgcacgtctgcaccgcaagctgcccctgggcgagcccgtatgccaaccc
gttgatgctgttctggccgggcgccgcaacaacccgccggaaccgggcatccgccccctg
gcggtgtacaaccccattcactaccaggaactgcccgagctgttcatggacttcatctgt
tccctcacgggcaagtcaccatccaccacgggtgccggcagcgaaggcgctctgaccaaa
gggccgttcaatgccctgcggcccacggcagacctgaacaacgccctggtgtccttcata
ctcacgggttacgccggctactccagttctgcgggcttcatcggtcccgacctgcgagtg
gatcatgacatcagcctgctcattcccgagatctgggcgcgcctgcaccccagccagagg
gatccgaaaaatcttatcgagcacggttacctggaacctctgcacgacttcgaacacaag
ggcgaaaaagtgctggccagccgcctgggataccgcattaccgaccgcttcgtgcatggc
ttcctgggcaagatcttcgacaaccccaaccaggtattcacggatgagattctcaagccg
gaaacccagaatatggatatattcgccgatggtgtaggcaacatcgtggaagcccagcgc
aaggtagcccagcgctatctggatgatggctccattgacgaagcctgtccgcccctgcgc
gccctgctgtacatcatggccacgggtgaatatgaagggaaagatgcccaccatcccgag
atccgtgccatgttcacccgcgaatccctgctggcctcggactggtaccatgagcgtctg
gaagtgaaacagcagcgtgatgtcacgctctgggaagggcatattgctgctctggagagc
ttcctggcccaacccggctatgaggacgaagcgcggcgcctgaacatcgcgcaacgattg
gagagcgccagagcaaggctggcccgtacccgcagcccggattacctggaatccctggtg
ggcaccattggtgccgatcccctgcggccctcggcgacggcaggcgccgcaaccgcccgc
gaagaaaaacaggtggcctga

DBGET integrated database retrieval system