KEGG   Thermoanaerobacter brockii: Thebr_0115
Entry
Thebr_0115        CDS       T01409                                 

Definition
(GenBank) tyrosyl-tRNA synthetase
  KO
K01866  tyrosyl-tRNA synthetase [EC:6.1.1.1]
Organism
tbo  Thermoanaerobacter brockii
Pathway
tbo00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:tbo00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Thebr_0115
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tbo01007]
    Thebr_0115
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:tbo03016]
    Thebr_0115
   03029 Mitochondrial biogenesis [BR:tbo03029]
    Thebr_0115
Enzymes [BR:tbo01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.1  tyrosine---tRNA ligase
     Thebr_0115
Amino acid related enzymes [BR:tbo01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   Thebr_0115
Transfer RNA biogenesis [BR:tbo03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Thebr_0115
 Prokaryotic type
    Thebr_0115
Mitochondrial biogenesis [BR:tbo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Thebr_0115
SSDB
Motif
Pfam: tRNA-synt_1b S4 TyrRSs_C Radical_SAM
Other DBs
NCBI-ProteinID: ADV78747
UniProt: E8UTL5
LinkDB
Position
103140..104360
AA seq 406 aa
MSALDVLQERGYIQQMTHEEEIRELLEKEKITFYIGFDPTADSLHVGHFLQIMVMSHMQK
AGHRPIVLIGGGTAMVGDPSGRTDMRKMLTKEEINRNAEAFKKQMQRLIDFSDGKAIMAN
NADWLLNLNYIEFLRDIGVHFSVNRMLTAECFKSRLERGLSFLEFNYMLMQAYDFLELNK
RYNCVMQMGGDDQWSNIIAGIELIRKKEGKQAYGMTFTLLTTSEGKKMGKTQKGAVWLDP
NKTSPYEFYQYWRNIADADVEKALALLTFLPMDEVRRLGALKDKEINEAKKILAYEVTKL
IHGEEEAIKAQKAAEALFESGGDLDNVPSVTVSSDVLGKKILDVLFEAKIIPSKSEGRRL
VQQGGLYINNEKVESIDEYIKDDMIKDNSILIRKGKKEYHRLVIKE
NT seq 1221 nt   +upstreamnt  +downstreamnt
gtgtctgcacttgatgttttacaagaaagaggatatattcagcaaatgactcatgaagag
gaaataagagagcttttagagaaggaaaaaatcacattttacataggttttgaccctact
gcagacagtttgcatgtaggacattttcttcaaattatggtgatgtctcacatgcaaaaa
gcaggccacaggcctattgtgttaataggcggcggcacagccatggtaggagacccaagc
ggcaggactgatatgaggaagatgttaactaaagaggaaataaatagaaatgctgaagct
tttaaaaagcaaatgcaaaggcttatcgatttctctgatggcaaagccatcatggcaaat
aatgctgattggcttttaaacttaaattatattgaatttttgcgagatataggggttcac
ttctctgtaaatagaatgcttacagcagaatgctttaagtcccgattagaaagaggtctt
tcctttttagaatttaactacatgctgatgcaagcttatgattttcttgaattaaataaa
agatacaattgtgtaatgcaaatgggcggagacgatcaatggtctaatattattgctgga
atagagcttatacgaaaaaaagaaggcaaacaggcttatggtatgacatttactttactt
acaaccagtgaagggaagaaaatgggaaaaacacaaaagggagcagtgtggcttgacccg
aataagacttctccttatgaattctatcaatactggagaaatatagctgatgcggatgtg
gaaaaggccctggcacttctcactttcttgcctatggatgaagtgagaagattaggggca
ttaaaagataaagagataaacgaggcgaaaaaaatattggcatatgaggtcacgaaactt
atacacggagaggaagaggctataaaagcccaaaaggcggcagaggctttatttgaaagt
ggtggagatttagataatgtgccttctgttactgtctcttctgatgttttaggtaaaaaa
attttagatgtgctttttgaagcaaagataataccttcaaagagtgagggtagaaggctc
gttcaacaaggtggactgtatataaacaatgaaaaagttgaaagcattgatgaatatata
aaagatgatatgataaaagataatagcattttaataagaaagggcaaaaaagagtatcac
aggcttgtcattaaagaataa

DBGET integrated database retrieval system