KEGG   Thermoanaerobacter brockii: Thebr_0195
Entry
Thebr_0195        CDS       T01409                                 

Definition
(GenBank) arginyl-tRNA synthetase
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
tbo  Thermoanaerobacter brockii
Pathway
tbo00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:tbo00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Thebr_0195
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tbo01007]
    Thebr_0195
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:tbo03016]
    Thebr_0195
   03029 Mitochondrial biogenesis [BR:tbo03029]
    Thebr_0195
Enzymes [BR:tbo01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     Thebr_0195
Amino acid related enzymes [BR:tbo01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   Thebr_0195
Transfer RNA biogenesis [BR:tbo03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Thebr_0195
 Prokaryotic type
   Other AARSs
    Thebr_0195
Mitochondrial biogenesis [BR:tbo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Thebr_0195
SSDB
Motif
Pfam: DALR_1 tRNA-synt_1d Arg_tRNA_synt_N tRNA-synt_1e tRNA-synt_1f tRNA-synt_1g tRNA-synt_1
Other DBs
NCBI-ProteinID: ADV78823
UniProt: E8UU13
LinkDB
Position
204445..206133
AA seq 562 aa
MENIIQKVKDEIKDMVTTAIKNSVKEGLMNIEVIPEIEIEEPKEKQHGDLAINTAMVIAK
QAKMPPKKIAEIIVSKMDPSNTFIEKIEIAGPGFINFFLKDKFLEETLKLVYERGKDYGR
VNIGNGKKVQVEFVSANPTGPMHMGNARGGALGDALAAVLDYAGYDVTREFYINDAGNQI
EKFGYSLEARYLQLLGIPAEVPEGGYQGEDIIDRAREFLEIYGDKYKDVPSEVRRKALID
YGLKKNLEKIKEDLALYGIEYDVWFSEQSLYDSGEVYKVIEELKQKGYTYEKDGALWFKM
TLFGAEKDDVLVRTNGFPTYLASDIAYHKNKFITRGFDWVINVWGADHHGHVAPMKGAMQ
ALGIDPDRLDVVLMQLVKLIEGGQVVKMSKRTGRMVTLRDLIDEVGKDAARFFFNMRSAD
SSIDFDLDLAKEQSNENPVFYVQYAHARICSIIRQLEEEGVKIDNIDEVDLSLLKEEEEK
ELIKKLAYFPEEITIAAKTLAPHRITRYILDVASLFHSFYNSHRVKGVEEDLMKARFVLI
LAVKTVIKNALDILKITAPERM
NT seq 1689 nt   +upstreamnt  +downstreamnt
ttggaaaacattatacaaaaagtaaaagatgaaataaaagacatggtgactaccgctatt
aagaattctgtaaaagaaggtttgatgaatatagaggttattccagagatagaaatagag
gagccaaaagaaaaacaacatggtgaccttgcaataaacacagcgatggtaatagcaaag
caggctaaaatgccccctaagaaaattgcggaaatcattgtttcaaaaatggacccttca
aatacttttatagaaaagattgaaattgcaggacctggctttatcaatttctttttgaag
gataaatttttggaagaaactttaaagctcgtttatgaacgaggaaaagattatggacgt
gtaaatataggaaatggcaagaaagtgcaagtggaatttgtatcggcaaatccgacgggt
cctatgcatatgggaaacgcaagaggtggtgctttgggagatgccttggcggcagtactt
gactatgcaggatacgatgttacaagagaattttatataaacgacgcaggaaatcaaata
gaaaaatttggatattcccttgaggcaagatacctgcaattattgggtataccagctgaa
gtgcccgaaggtggctaccaaggagaggacataatagatagagcgagagaatttttagaa
atatacggagataaatataaagatgtgccatcagaagtgagaagaaaggcactcatagat
tatggacttaagaaaaatttagaaaaaataaaagaggatttagctctttacgggatagaa
tatgacgtgtggttttctgagcaatctctttatgacagcggagaagtgtataaagtaatt
gaagagcttaagcaaaaaggatacacttatgaaaaagacggggctttgtggtttaaaatg
acattatttggcgcagaaaaagacgatgtattagttaggaccaatggatttcctacatat
ctcgcttctgacatagcctatcacaaaaataaatttataactcgcggatttgactgggtt
ataaatgtgtggggggcagatcaccacggccatgttgctcctatgaaaggagcgatgcag
gcacttggtatagaccctgataggcttgatgttgttttaatgcagcttgtgaaactcata
gagggcggtcaagttgttaaaatgtccaaaaggacaggcagaatggtgacactacgagat
ctgatagatgaagtagggaaagatgcagcgcggtttttcttcaacatgaggtctgcagac
agttccattgattttgaccttgacctagctaaagaacagtcaaatgaaaaccctgtcttt
tatgtccagtatgcccatgcgaggatttgctccataataaggcagttagaagaagagggt
gtaaagatagataatatagatgaagtagatttaagccttttaaaagaagaagaggaaaaa
gaattaattaaaaaattggcatatttccctgaagaaattactattgctgcaaagacattg
gcaccccacagaattacgaggtacatacttgatgtagcatcgcttttccattctttttat
aacagccatagagtaaaaggcgtagaagaagatttgatgaaagcaaggtttgtgctcata
ttagcagtaaagactgttataaagaacgctttagatatattgaaaataacagcaccagag
agaatgtaa

DBGET integrated database retrieval system