KEGG   Tribolium castaneum (red flour beetle): 100141670
Entry
100141670         CDS       T01046                                 

Definition
(RefSeq) balbiani ring protein 3
  KO
K05449  vascular endothelial growth factor C/D
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
KEGG Orthology (KO) [BR:tca00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:tca04052]
    100141670
Cytokines and growth factors [BR:tca04052]
 Growth factors
  Growth factors (RTK binding)
   100141670
SSDB
Other DBs
NCBI-GeneID: 100141670
NCBI-ProteinID: XP_015834682
UniProt: D2A033
LinkDB
Position
LG4
AA seq 234 aa
MECIQVIFLVLLLTVSISTKQRMKYSDHDILEKSEVTVKFPTYALKIPPFITARKRTSTN
LSTTPVTCNSANVSQALKDLRKKIKCVPRETVVEVAAPDGFKVYPNTFVVNRCGGMCTGG
KKCLPTRKTDAEFYVRSVKIKTGMNYCNRIKVPADTECTCGCPEKKKCLSDQKFDPILCK
CVCTNKEEEEKCLEKLNMNFKWKSKDCTCGCKREKNCTTGTVWKREECRCVKEA
NT seq 705 nt   +upstreamnt  +downstreamnt
atggagtgcatccaagtgatttttctcgtgttgttgctcacagtttcgatttccaccaaa
caacgaatgaaatattcggaccacgacattttagaaaaatcggaagttacggtgaagttc
cccacatacgctttgaaaattccaccgttcataacagcccggaaacgcactagtactaac
ttaagtaccacgccagttacttgcaattctgcgaacgtgtcgcaagcccttaaagacctg
cggaaaaaaatcaagtgtgtaccacgggagacggtggtcgaagtcgccgcccccgacggc
ttcaaagtgtaccctaacacttttgtagtcaaccggtgcgggggcatgtgcaccggtggg
aaaaagtgtctaccaactaggaaaaccgacgctgaattttacgtcaggagcgttaaaatc
aaaactgggatgaattactgtaaccggatcaaagttcctgcagacacagagtgtacttgt
gggtgtcccgagaagaaaaagtgtttgagcgaccaaaagttcgacccgattttgtgtaaa
tgtgtttgtacaaataaggaggaagaggaaaagtgtttggaaaaattaaatatgaatttt
aagtggaagtcaaaggattgcacctgtggctgcaaacgggaaaaaaattgcaccactgga
actgtgtggaagcgggaggagtgtaggtgcgtaaaagaggcataa

DBGET integrated database retrieval system