KEGG   Tribolium castaneum (red flour beetle): 655054
Entry
655054            CDS       T01046                                 

Definition
(RefSeq) bcl-2-related ovarian killer protein
  KO
K20017  Bcl-2 family protein
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca04214  Apoptosis - fly
tca04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:tca00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    655054
   04215 Apoptosis - multiple species
    655054
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 655054
NCBI-ProteinID: XP_966641
LinkDB
Position
LG5
AA seq 264 aa
MVTASRPMEAASRPRGPPRRKFSFPAALTITDPLPPNSKRRFSNVGDAVTRKLSTTIGWR
RPPEEVVAVGRALCVLYIRSRLKRAGLFNRKLGLTRVRSTVSAVPGGGSATVREVFPGLA
CACAELERAHPRLYLNIARQTGVGPETGAGGLLAAIGHQLLRCEPSWGKVVAVYSVAGGL
AVDSVRLGHPEHVHDLIDGMTELLEDRMAMWVAANGGWTGLSSHCRPEDQDISFVEYLGI
LALVLAILLTAYIIVRFFVKFSML
NT seq 795 nt   +upstreamnt  +downstreamnt
atggtgaccgcgtcgaggcccatggaggcggcgtcccgcccccgcggccccccgcgccgc
aagttcagttttcccgccgccttgaccatcaccgacccactccctcccaactccaaacgc
cgtttcagcaacgttggagacgccgtcactcgcaaactctcaaccaccatcggctggcgg
cgcccccctgaagaagtggtcgccgtaggccgagctctctgcgtcctctacatccgaagc
cggctaaaacgggccggacttttcaaccgtaaattggggctcactcgtgttcgaagcacc
gtgagtgccgtccctgggggcggcagcgccacggttcgggaggtgttcccgggcttggcg
tgtgcctgcgccgagttggagcgggcgcatcctagactttacttaaatattgcgagacag
actggagtggggcccgaaacgggggctggggggctgctggccgctattggacatcaactg
ttgaggtgtgagccctcgtggggtaaagttgtggcggtttacagtgtggcaggggggctg
gcggtggatagtgtgaggttggggcatccagagcatgtgcatgatttgatcgatgggatg
acggagttgttggaggataggatggccatgtgggtggcggctaatgggggctggactggt
ttgagtagtcactgccgaccggaggaccaagacatctctttcgtcgaatatcttggaatc
ttggctttagtattagcaatcctacttacggcctacatcatagtcagatttttcgtaaaa
ttcagtatgttgtag

DBGET integrated database retrieval system