KEGG   Tribolium castaneum (red flour beetle): 657568
Entry
657568            CDS       T01046                                 

Definition
(RefSeq) adenylate cyclase type 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca00230  Purine metabolism
tca01100  Metabolic pathways
tca04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:tca00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    657568
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    657568
Enzymes [BR:tca01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     657568
SSDB
Motif
Pfam: Guanylate_cyc AC_N RINT1_TIP1
Other DBs
NCBI-GeneID: 657568
NCBI-ProteinID: XP_001810222
UniProt: D6WK82
LinkDB
Position
LG5
AA seq 1063 aa
MEEQKSSGQMKNLCWVFSSFRDSALEKLYQSFSVRQKRAGLECFLITAILFDIYMLVVPS
DQDFVIIAVMGTFLIVNSFLLIWCKKGFQNKPLWTVVPHIAFHIANTQILAGLFLKKNEV
TPRDSLGWFLLLTYLIYVTLPLRLPFCVLLSIGTFTSYIVSLCGLTKSQLHFVEQQVSNC
ILLVTANILGLTSYLVEDKQQRRAFLETRQSLEMKLVIEEQSAEQERLLLSVLPEHVAVQ
MRQDLDQADSQFKKIYMSRHENVSILYADIVGFTAISSTYSAQELVKMLNELFARFDKLA
EKYQQLRIKILGDCYYCISGAPRERPDHAVLCVHMGLSMVKAIKYVQQTANSPVDMRVGI
HTGAVLAGVLGQRQWQFDVYSKDVELANKMESSGMAGRVHISATTYSFLNGEFEVEPGYG
EKREEALRIAGLKTYFIVKVLKPFQPPVTEVQNGSSILPEEDSCVIAEISDTKDGDVDDG
NQKRSREDSRDFKIRLRTELVNRDGHKELSKNTTCLTLNFVDEKKEKLYQQQVETFSSIT
LLMFLVVRLSIGLTVFTVLPRDMSINISYCTENVIIIVLVSILICDEFLPLKCWNAFKDS
VTVRRILSAICVFLLGTVNLIDTISCVQFHSNDNCTFTDDINSSCLYPSYFSYFAVLILI
ASSLPACLSYLWKALFLFIIALAQCLVNIFVLELVLECEESRKNWKSLTKGKYTLSALLL
IATLALAFLARHMEQVARVLFLWRCEVEEQRDFAEDMRRRNEALVYNILPPHVAAHFMGN
RKRQHDELYSQSYAEIGVLFASMPNFSDFYSEETVNNQGLECLRFLNEVISDFDALLELP
QFQDIIKIKTIGSTYMAASGLNPTRQVKPDDPITVRWAHLALLVEFALELKKALQGINEQ
SFNHFVLKLGINHGPITAGVIGARKPHYDIWGNTVNVASRMESTGKAGCIQVTEETCEIL
QHFGYQFEQRGLVAVKGKGQLMTYYLLGKAGKITPPTAPVSPIIGVTAMETVNEEDESHD
SPTSKSEDKTVIECTDQKIEDEVFTTDTEQNFSTKEAEPLLQC
NT seq 3192 nt   +upstreamnt  +downstreamnt
atggaggagcaaaaatcgtcaggacagatgaaaaacctgtgctgggttttcagcagcttt
cgcgattcggcactcgaaaagctttaccagagtttcagcgtgaggcagaagcgcgctggg
ttggaatgtttcctgataacggcaattctcttcgatatttacatgttggtggttcccagc
gaccaggattttgtcataatcgcagtgatgggcacatttctcattgtcaattcttttctg
ctaatctggtgtaagaaggggttccaaaacaagccgctgtggactgtggtaccgcacatt
gctttccacattgccaacactcagatactcgccgggctgttcttgaagaagaacgaagtg
acacccagagatagtctaggctggtttttgctcctaacttacttaatttatgtcacacta
ccgctaagactgcctttttgcgttctgctcagcattggaacgttcacttcgtacatcgtt
tcgctgtgcggattgaccaaatcacaacttcatttcgtggagcagcaagtctccaactgc
atcttgttggttactgcaaatatcttggggctgacatcttatcttgtcgaagataaacag
cagcgacgggccttcttagaaactagacaatcattggaaatgaaacttgttatagaggag
caaagtgccgaacaggaacgtttacttctatccgttctcccggaacatgtggcggtacaa
atgagacaggatttggaccaagccgacagccaatttaagaaaatttacatgagcaggcac
gaaaacgtaagtattttgtatgccgacatcgtgggatttacagcgatctcatcaacatat
tcagctcaagagcttgtaaaaatgctgaatgaattatttgcaagattcgacaaacttgcc
gagaaataccaacagctgagaataaagattttaggagactgctattattgcattagtggt
gcgccgagggagcgtccagatcatgcagttctttgtgttcatatgggactgtcgatggtc
aaagcgataaaatatgtacagcaaacagcgaattctcctgtagatatgagagttggaatt
cacacgggagcggttctagcgggagttctgggccagagacaatggcaattcgacgtctac
tcgaaggacgttgaattagccaacaaaatggaaagcagcggcatggcaggacgagtgcat
atttctgccacaacctattcgttccttaatggtgagttcgaagtcgaacctggttatggc
gagaagcgggaagaagcactgcgaatagcaggattaaaaacctacttcatcgtcaaagtt
ttaaaaccatttcaaccgcctgttacggaagttcagaatgggagtagtatacttccagaa
gaggacagttgtgtaattgcagaaatttcagacacaaaggatggagatgttgacgatgga
aaccaaaaaagatcgcgggaagactcgcgagactttaagatcagattaagaacagaactg
gttaacagagacggtcataaagagttgtctaagaacacgacatgtttgactcttaatttc
gtggacgaaaagaaggaaaagttgtatcaacagcaggtcgagacattttcaagcataaca
ctgctaatgtttctcgtagttcgcctgtccattggcttaacggttttcactgtcttacca
agggacatgtcaatcaatatatcgtactgtacagaaaatgtaataataatagtcctcgtc
tccatcctcatttgcgacgaatttttgccgctgaaatgctggaacgcttttaaggattca
gtaacagttcgtcggatcctgtcggcaatttgtgtctttcttttaggaacggtcaatcta
atagacacaatttcttgtgttcagttccattcgaacgataattgcacgttcactgacgat
ataaattcgtcatgtctctatccctcctatttcagttatttcgccgttctaattctgatc
gcttcctctcttccagcctgcctctcatatctctggaaggctctgtttctgtttatcata
gctctggctcaatgcctcgtgaacattttcgtcttagaattagtactcgagtgcgaggag
tcgcggaaaaactggaaaagcttaactaagggtaaatacacgctttcagcgttgttgctc
attgccacgctcgctttggctttccttgcgagacatatggagcaggtggcgagagttttg
ttcttatggcggtgcgaggtcgaggagcaacgcgatttcgccgaggatatgagaagaaga
aatgaagctctggtgtataatatccttccgccacatgtagcggcccattttatggggaac
aggaagaggcaacacgatgaactttactcgcaaagttacgccgagattggggtgcttttt
gcctcgatgcccaacttttctgacttctattcagaggagaccgtcaacaatcagggctta
gaatgtctgcgatttctgaacgaagtcatttcagatttcgatgctcttttagagctacct
cagtttcaagacataataaaaattaagacaatcggttctacgtacatggcagcaagcggc
ctaaacccgactcgacaagtcaaacccgacgaccccataacagtgcgatgggcgcatctt
gccctccttgttgaattcgcactggagctgaagaaggccttacagggcatcaacgaacaa
agttttaaccattttgttttaaaattaggtatcaaccatgggcctatcacagcgggagta
atcggagctagaaaaccccactacgacatctggggcaacacggtcaatgtagcttccagg
atggaaagtaccggaaaagctggatgtattcaggtgactgaagagacgtgcgaaatcctg
cagcacttcggctaccagttcgagcagcgcggcctagtggcagtgaagggaaaaggccaa
ctgatgacctactacttgctcgggaaagccgggaaaatcacccctcctacggctccggtc
tctccaatcataggtgtcaccgcaatggaaactgtaaacgaagaggacgaatcgcacgat
agtcctacgtccaaatccgaggataaaacagtaatcgaatgcaccgaccagaaaatcgaa
gacgaagttttcacaacggacaccgagcagaattttagtaccaaagaagcggaaccgctg
ctgcagtgttaa

DBGET integrated database retrieval system